KEGG   Escherichia coli K-12 W3110: JW1536
Entry
JW1536            CDS       T00068                                 
Symbol
ydfJ
Name
(GenBank) predicted transporter
  KO
K08173  MFS transporter, MHS family, metabolite:H+ symporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1536 (ydfJ)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    JW1536 (ydfJ)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_2 MFS_1_like
Other DBs
NCBI-ProteinID: BAA15248
UniProt: P77228
Position
complement(1632716..1633999)
AA seq 427 aa
MDFQLYSLGAALVFHEIFFPESSTAMALILAMGTYGAGYVARIVGAFIFGKMGDRIGRKK
VLFITITMMGICTTLIGVLPTYAQIGVFAPILLVTLRIIQGLGAGAEISGAGTMLAEYAP
KGKRGIISSFVAMGTNCGTLSATAIWAFMFFILSKEELLAWGWRIPFLASVVVMVFAIWL
RMNLKESPVFEKVNDSNQPTAKPAPAGSMFQSKSFWLATGLRFGQAGNSGLIQTFLAGYL
VQTLLFNKAIPTDALMISSILGFMTIPFLGWLSDKIGRRIPYIIMNTSAIVLAWPMLSII
VDKSYAPSTIMVALIVIHNCAVLGLFALENITMAEMFGCKNRFTRMAISKEIGGLIASGF
GPILAGIFCTMTESWYPIAIMIMAYSVIGLISALKMPEVKDRDLSALEDAAEDQPRVVRA
AQPSRSL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggatttccagttatattcgctcggcgcagcgttagtgtttcatgaaatattttttcct
gaatcatcaacggcaatggcgttaattctggcaatgggaacctacggtgcaggttatgtg
gcgcgtattgtcggagcatttattttcggcaaaatgggcgacagaatagggcgtaaaaaa
gtgctctttattaccatcaccatgatggggatctgtaccaccttaattggtgtgttaccg
acctatgcacagattggtgtttttgcacccatcttgctggtgacgttgcgtattattcag
gggttgggtgcaggtgcggaaatttccggtgccggtacgatgctggcggaatatgcgcca
aaaggtaagcgcggaattatctcctcatttgtggctatgggaactaactgcggaaccttg
agcgcaacggcaatctgggcctttatgttcttcattctcagtaaagaggaactgctggcg
tggggatggcgtataccgttcctggcgagtgttgtcgtgatggtctttgctatctggttg
cgtatgaatctgaaagaaagcccggtctttgagaaggttaacgacagtaaccaaccgaca
gcaaaacctgcacctgctggtagcatgttccagagcaaatccttctggctggcaacaggg
ctgcgttttggtcaggcgggtaactccgggttaattcagactttccttgcaggctattta
gtgcagacgttattgtttaacaaagcaattccaacagatgcattgatgatcagttcgatt
ctcggctttatgaccattccgttccttggttggttatccgataaaattggtcgccggatc
ccgtatattattatgaatacctccgcgattgtgctggcatggccaatgctttctatcatt
gtagataaaagctatgccccgagcaccattatggttgcactgattgtgattcataactgt
gcggtgctgggattatttgctctggaaaacattaccatggcagaaatgttcggctgtaaa
aaccgctttacccggatggctatttctaaagaaattggtggtcttatcgcttccggtttt
ggtcctatcctggcgggtattttctgcaccatgacggaatcctggtatccgatcgccatt
atgatcatggcatattcagtgattggtttaatctctgcgctgaaaatgccagaggtgaaa
gaccgtgatttaagtgcgctggaagacgctgcggaagatcaaccgcgtgttgtaagagct
gcgcaaccttccagaagtctgtaa

DBGET integrated database retrieval system