KEGG   Escherichia coli K-12 W3110: JW1572
Entry
JW1572            CDS       T00068                                 

Gene name
rspB
Definition
(GenBank) predicted oxidoreductase, Zn-dependent and NAD(P)-binding
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00040  Pentose and glucuronate interconversions
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JW1572 (rspB)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     JW1572 (rspB)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N Sacchrp_dh_NADP 2-Hacid_dh_C NADH_4Fe-4S Shikimate_DH
Other DBs
NCBI-ProteinID: BAA15284
UniProt: P38105
Structure
PDB: 
4ILK

Position
complement(1654610..1655629)
AA seq 339 aa
MKSILIEKPNQLAIVEREIPTPSAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGEGVESARVGERVAVDPVVSCGHCYPCSIGKPNVCTTLAVLGVHADGGFSEY
AVVPAKNAWKIPEAVADQYAVMIEPFTIAANVTGHGQPTENDTVLVYGAGPIGLTIVQVL
KGVYNVKNVIVADRIDERLEKAKESGADWAINNSQTPLGEIFTEKGIKPTLIIDAACHPS
ILKEAVTLASPAARIVLMGFSSEPSEVIQQGITGKELSIFSSRLNANKFPIVIDWLSKGL
IKPEKLITHTFDFQHVADAISLFEQDQKHCCKVLLTFSE
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaaaagcatattaattgaaaaaccgaatcaactggcgattgtcgaacgtgaaataccc
accccgtcagcgggtgaagtacgagtaaaagtgaaacttgccggaatttgtggttcagat
agccatatttatcgtgggcataatccttttgcgaaatatccgcgcgtcattggtcatgaa
ttctttggcgtcattgatgcagtgggtgaaggcgtggaaagcgccagagtcggtgaacgt
gttgctgtcgatccggtggtcagctgtgggcattgctatccgtgctctataggtaaaccg
aacgtttgtacgacactggctgtattaggtgtgcacgctgacggtggtttcagtgaatat
gccgtggttccggcaaaaaatgcgtggaaaattcctgaagcagtggccgatcaatatgcg
gtaatgatcgaaccttttaccattgcggctaacgtaaccggacatggtcaaccgactgaa
aatgataccgttctggtttatggtgccggtccaatcggcctgacgatcgttcaggtatta
aaaggcgtctataacgttaaaaatgtgattgttgccgatcgcattgatgaacgactggaa
aaagcgaaagagagcggggctgactgggcgattaataacagccagacaccgcttggcgag
attttcactgaaaaaggcatcaagccgacattaattatcgatgcggcttgtcatccttct
atcctgaaagaggccgtaacgctggcttctccagcggcacgtattgtattgatggggttc
tccagtgaaccgtctgaagtgattcagcaaggaattaccggaaaagaactctctattttc
tcttcacgcttaaatgcaaataaattcccgatcgttatcgactggttaagtaaagggtta
attaaaccagaaaaattaattacccatacgtttgatttccagcatgttgctgatgccatt
agtttatttgaacaggatcaaaaacattgctgcaaagtcttactcactttttctgaataa

DBGET integrated database retrieval system