KEGG   Escherichia coli K-12 W3110: JW1587
Entry
JW1587            CDS       T00068                                 

Gene name
ynfL
Definition
(GenBank) predicted DNA-binding transcriptional regulator
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_24 MarR_2 PBP_like_2
Other DBs
NCBI-ProteinID: BAA15319
UniProt: P77559
Position
complement(1670413..1671306)
AA seq 297 aa
MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTNRSVLLT
AAGKQFLADSRQILSMVDDAAARAERLHQGEAGELRIGFTSSAPFIRAVSDTLSLFRRDY
PDVHLQTREMNTREQIAPLIEGTLDMGLLRNTALPESLEHAVIVHEPLMAMIPHDHPLAN
NPNVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYHLTPVITQEVGEAMTIIGLVSAGL
GVSILPASFKRVQLNEMRWVPIAEEDAVSEMWLVWPKHHEQSPAARNFRIHLLNALR
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaatattgaacttcgtcatctgcgttactttgttgctgttgcggaagagctgcatttc
gggcgcgccgctgcccgcctgaatatttcgcaaccgccgctaagtcagcagattcaggcg
ctggagcaacaaattggtgcccgactgctggcacgaaccaatcgcagtgtattgctgacg
gcagcaggaaaacagtttcttgcagatagtcggcaaatcctgtctatggtggatgacgct
gccgctcgcgctgaaaggctgcatcagggtgaagcgggggagttgcgcattggttttact
tcgtcggctccttttattcgggcggtgtccgatacgttatcgctgtttcgccgtgattat
cctgatgtccatttacaaacccgcgaaatgaacactcgcgagcaaatcgctccgctcatt
gaaggaacgctggatatgggattgctgcgtaacacagcgttaccggagtcgcttgaacac
gcagtcatcgtccatgaaccgcttatggcgatgatcccgcacgatcatcccctggcaaat
aacccgaatgtaacgctggctgaactggcgaaagaaccctttgtcttttttgatccgcac
gtcgggacagggctgtatgacgatattctcgggctgatgcgacgttaccatttgacgccc
gtcatcactcaggaggtgggcgaggcaatgaccatcatcggtctggtttccgccggtctg
ggtgtttcaattttgcctgcgtcatttaaacgtgttcagctcaacgaaatgcgctgggtg
ccgattgctgaagaggatgcggtttctgaaatgtggttggtctggccgaaacatcatgaa
caaagtccggctgcgcgtaactttcgtattcatctgctgaatgctctcaggtga

DBGET integrated database retrieval system