KEGG   Escherichia coli K-12 W3110: JW1588Help
Entry
JW1588            CDS       T00068                                 

Gene name
ynfM
Definition
(GenBank) predicted transporter
  KO
K08224  MFS transporter, YNFM family, putative membrane transport protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1588 (ynfM)
Transporters [BR:ecj02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Acriflavin-sensitivity (YnfM) family [TC:2.A.1.36]
    JW1588 (ynfM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-ProteinID: BAA15330
UniProt: P43531
Position
1671413..1672666
Genome map
AA seq 417 aa AA seqDB search
MSRTTTVDGAPASDTDKQSISQPNQFIKRGTPQFMRVTLALFSAGLATFALLYCVQPILP
VLSQEFGLTPANSSISLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASICTLLSTM
MTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLIS
GVFTDFFNWRIALAAIGCFALASALMFWKILPESRHFRPTSLRPKTLFINFRLHWRDRGL
PLLFAEGFLLMGSFVTLFNYIGYRLMLSPWHVSQAVVGLLSLAYLTGTWSSPKAGTMTTR
YGRGPVMLFSTGVMLFGLLMTLFSSLWLIFAGMLLFSAGFFAAHSVASSWIGPRAKRAKG
QASSLYLFSYYLGSSIAGTLGGVFWHNYGWNGVGAFIALMLVIALLVGTRLHRRLHA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtactacaactgttgatggcgctccggcaagcgacactgacaagcaaagcatt
tctcagccaaatcaatttattaaacgcggtacgccgcaatttatgcgcgtcaccctggcg
ctgttctctgccggactggcaacatttgcacttctctattgtgtgcagcctatccttccg
gtgctttcgcaggagtttggcttaacccccgcgaacagtagtatttcactgtccatttcc
acggcgatgttggctattggtttgctgtttactggcccgctatccgatgccattggtcgc
aaaccagtgatggtcacggcgctactgttggcctccatttgtacgttactttcgacaatg
atgaccagctggcacggcattttgattatgcgcgccttgattgggctttcgttaagtggc
gtggcagctgttggcatgacttatcttagcgaggaaatccatcccagtttcgtggccttt
tcaatggggttgtatatcagcggcaactcaattggcggcatgagcggacgcttaattagc
ggtgtcttcacggactttttcaactggcgaattgctctggcggcaatcggttgtttcgcg
ctggcctcggcgttgatgttctggaaaatcctccctgaatcacgccattttcgcccgact
tcgctgcgccctaagacgttgtttatcaactttcgtctgcactggcgtgaccggggatta
ccgttattgttcgcagaaggctttttgctgatggggtcgttcgtcacgctgtttaattac
atcggctatcggttgatgctctccccctggcatgtcagtcaggccgtggttggcttatta
tcgctggcttatttgaccggtacatggagctcacccaaagccggaaccatgaccacccgc
tatgggcgtggtccagtgatgttgttttcgacgggggttatgctgtttggtttactgatg
accttattcagctcgctgtggctgatctttgccggaatgttactcttctcagcaggattc
ttcgcagcccactcagtagccagcagctggatcggcccccgcgcaaaacgcgctaaaggc
caggcctcctcgctgtatctgttcagttactatctggggtcgagtattgccgggacgctg
ggtggtgttttctggcataactatggctggaacggcgtcggcgcatttattgctctgatg
ctggtcattgctctgctggtcgggacgcgtttgcatcgtcgtctgcacgcctga

DBGET integrated database retrieval system