KEGG   Escherichia coli K-12 W3110: JW1591
Entry
JW1591            CDS       T00068                                 

Symbol
mdtI
Name
(GenBank) multidrug efflux system transporter
  KO
K11742  spermidine export protein MdtI
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1591 (mdtI)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW1591 (mdtI)
SSDB
Motif
Pfam: Multi_Drug_Res EamA UPF0060 TMEM234 Nuc_sug_transp
Other DBs
NCBI-ProteinID: BAA15333
UniProt: P69210
Position
complement(1674534..1674863)
AA seq 109 aa
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID
LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcgcagtttgaatgggttcacgccgcctggctggcattggcaatcgtgctggaaatc
gttgctaacgtctttttgaaattttctgacggctttcgtcgcaaaatatttggcttgctc
tccctggcggcggtgctggctgcctttagtgcgctttctcaagccgttaaagggatcgac
ttgtctgtcgcttatgcattgtggggcgggtttggtattgccgccacgttagccgcaggt
tggatcttgtttggtcaacggttaaatcgtaaaggctggattggcctggtcttgctgttg
gctggaatgatcatggtgaaacttgcctga

DBGET integrated database retrieval system