KEGG   Escherichia coli K-12 W3110: JW1607Help
Entry
JW1607            CDS       T00068                                 

Gene name
uidC
Definition
(GenBank) predicted outer membrane porin protein
  KO
K16140  putative glucuronide porin
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1607 (uidC)
Transporters [BR:ecj02000]
 Other Transporters
  Pores ion channels [TC:1]
   JW1607 (uidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OprD
Motif
Other DBs
NCBI-ProteinID: BAE76482
UniProt: Q47706
Position
complement(1693300..1694565)
Genome map
AA seq 421 aa AA seqDB search
MRKIVAMAVICLTAASGLTSAYAAQLADDEAGLRIRLKNELRRADKPSAGAGRDIYAWVQ
GGLLDFNSGYYSNIIGVEGGAYYVYKLGARADMSTRWYLDGDKSFGFALGAVKIKPSENS
LLKLGRFGTDYSYGSLPYRIPLMAGSSQRTLPTVSEGALGYWALTPNIDLWGMWRSRVFL
WTDSTTGIRDEGVYNSQTGKYDKHRARSFLAASWHDDTSRYSLGASVQKDVSNQIQSILE
KSIPLDPNYTLKGELLGFYAQLEGLSRNTSQPNETALVSGQLTWNAPWGSVFGSGGYLRH
AMNGAVVDTDIGYPFSLSLDRNREGMQSWQLGVNYRLTPQFTLTFAPIVTRGYESSKRDV
RIEGTGILGGMNYRVSEGPLQGMNFFLAADKGREKRDGSTLGDRLNYWDVKMSIQYDFML
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagtggccatggccgttatttgcctgacggctgcctctggccttacctct
gcttatgcggcgcaactggctgacgatgaagcgggactacgcatcagactgaaaaacgaa
ttgcgcagggcggataagcccagtgctggcgcgggaagagatatttacgcatgggtacag
ggaggattgctcgatttcaatagtggttattattccaatattattggcgttgaaggcggg
gcgtattatgtttataaattaggtgctcgtgctgatatgagtacccggtggtatcttgat
ggtgataaaagttttggctttgccctgggggcagtaaaaataaaacccagtgaaaatagc
ctgcttaaattaggtcgcttcgggacggattatagttatggtagcttaccttatcgtatt
ccgttaatggctggcagttcgcaacgtacattaccgacagtttctgaaggagcattaggt
tattgggctttaacaccaaatattgatctgtggggaatgtggcgttcacgagtattttta
tggactgattcaacaaccggtattcgtgatgaaggggtgtataacagccagacgggaaaa
tacgataaacatcgcgcacgttcttttttagccgccagttggcatgatgataccagtcgc
tattctctgggggcatcggtacagaaagatgtttccaatcagatacaaagtattctcgag
aaaagcataccgctcgacccgaattatacgttgaaaggggagttgctcggcttttacgcg
cagctcgaaggtttaagtcgtaataccagccagcccaatgaaacggcgttggttagtgga
caattgacctggaatgcgccgtggggaagtgtatttggcagtggtggttatttgcgccat
gcaatgaatggtgccgtggtggataccgacattggctatcccttttcattaagtcttgat
cgtaaccgtgaaggaatgcagtcctggcaattgggcgtcaactatcgtttaacgccgcaa
tttacgctgacatttgcaccgattgtgactcgcggctatgaatccagtaaacgagatgtg
cggattgaaggcacgggtatcttaggtggtatgaactatcgggtcagcgaagggccgtta
caagggatgaatttctttcttgctgccgataaagggcgggaaaagcgcgatggcagtacg
ctgggcgatcgcctgaattactgggatgtgaaaatgagtattcagtatgactttatgctg
aagtaa

DBGET integrated database retrieval system