KEGG   Escherichia coli K-12 W3110: JW1615Help
Entry
JW1615            CDS       T00068                                 

Gene name
add
Definition
(GenBank) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00230  Purine metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JW1615 (add)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     JW1615 (add)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-ProteinID: BAA15374
UniProt: P22333
Position
1703947..1704948
Genome map
AA seq 333 aa AA seqDB search
MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFL
TKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVI
DGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLF
LSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQI
GIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGL
SREQIRQAQINGLEMAFLSAEEKRALREKVAAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccaccctgccattaactgatatccatcgccaccttgatggcaacattcgt
ccccagaccattcttgaacttggccgccagtataatatctcgcttcctgcacaatccctg
gaaacactgattccccacgttcaggtcattgccaacgaacccgatctggtgagctttctg
accaaacttgactggggcgttaaagttctcgcctctcttgatgcctgtcgccgcgtggca
tttgaaaacattgaagatgcagcccgtcacggcctgcactatgtcgagctgcgtttttca
ccaggctacatggcaatggcacatcagctgcctgtagcgggtgttgtcgaagcggtgatc
gatggcgtacgtgaaggttgccgcacctttggtgtgcaggcgaagcttatcggcattatg
agccggaccttcggcgaagccgcctgtcagcaagagctggaggcctttttagcccaccgt
gaccagattaccgcacttgatttagccggtgatgaacttggtttcccgggaagtctgttc
ctttctcacttcaaccgcgcgcgtgatgcgggctggcatattaccgtccatgcaggcgaa
gctgccgggccggaaagcatctggcaggcgattcgtgaactgggtgcggagcgtattgga
catggcgtaaaagccattgaagatcgggcgctgatggattttctcgccgagcaacaaatt
ggtattgaatcctgtctgacctccaatattcagaccagcaccgtagcagagctggctgca
catccgctgaaaacgttccttgagcatggcattcgtgccagcattaacactgacgatccc
ggcgtacagggagtggatatcattcacgaatataccgttgccgcgccagctgctgggtta
tcccgcgagcaaatccgccaggcacagattaatggtctggaaatggctttcctcagcgct
gaggaaaaacgcgcactgcgagaaaaagtcgccgcgaagtaa

DBGET integrated database retrieval system