KEGG   Escherichia coli K-12 W3110: JW1649
Entry
JW1649            CDS       T00068                                 

Gene name
ydhP
Definition
(GenBank) predicted transporter
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1649 (ydhP)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    JW1649 (ydhP)
SSDB
Motif
Pfam: MFS_1 MFS_4 Sugar_tr DUF1186
Other DBs
NCBI-ProteinID: BAA15423
UniProt: P77389
Position
complement(1737835..1739004)
AA seq 389 aa
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLM
TLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL
PKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHATPVFVT
AMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLAIPFLARNEFGAAISMVVW
GAATFAVVPPLQMRVMRVASEAPGLSSSVNIGAFNLGNALGAAAGGAVISAGLGYSFVPV
MGAIVAGLALLLVFMSARKQPETVCVANS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaattaactatccgttgctggcgctggcgattggcgcgtttggtatcgggacaacg
gagttctcgccaatgggcttgttgcccgtcattgcgcgcggtgtggatgtctcgattccc
gctgccggaatgttaatcagtgcctatgcagttggcgtaatggttggcgcgccgctgatg
acgcttctactttctcatcgtgcccgccgcagtgcgttgattttcctgatggcaattttc
acgctcggcaacgtactttccgccatcgcgccggattatatgaccctgatgctttcacgc
attttgaccagcctgaatcacggagcattttttggtttgggttcagtcgtggccgcaagc
gtggtgccaaaacataaacaggccagcgcagttgccactatgtttatggggttaaccctg
gcaaatatcggtggcgtgccggcggcgacctggttgggtgaaaccatcggctggcggatg
tcatttctggcaacggcggggctgggagtgatttcaatggtaagtctgttcttctcatta
cctaaaggtggtgcaggggcacgacctgaagtgaaaaaagagctggcggtattaatgcgt
ccgcaggtgctgtctgcattgctgacgacggtactgggagctggtgcaatgtttactctc
tacacctatatctctccggtactgcaaagtattacccacgcaacaccggtgttcgtcacg
gcaatgctggtgctgattggtgtcggattctctatcggtaactatctcggcggcaaactg
gcagatcgttcagttaacggcacgttgaaaggctttttgttgttgttgatggtgattatg
ctggcaatcccgttcctggcccgcaatgagttcggcgcagctattagcatggtggtgtgg
ggcgcagcaacctttgcggtcgtaccgccgttacagatgcgcgtgatgcgtgtcgccagt
gaagcgccaggtctgtcttcatcagtcaatattggtgcctttaatcttggaaatgcgctg
ggagcagctgctggtggtgcggtaatttccgctgggctgggatacagctttgtgccggtg
atgggagcgattgtcgcgggactggcattattgctggtgtttatgtcagccagaaaacaa
cctgaaacagtttgcgttgctaacagctaa

DBGET integrated database retrieval system