KEGG   Escherichia coli K-12 W3110: JW1660Help
Entry
JW1660            CDS       T00068                                 

Gene name
ydhU
Definition
(GenBank) predicted cytochrome
  KO
K08354  thiosulfate reductase cytochrome b subunit
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00920  Sulfur metabolism
ecj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    JW1660 (ydhU)
Transporters [BR:ecj02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   JW1660 (ydhU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB COX14
Motif
Other DBs
NCBI-ProteinID: BAA15442
UniProt: P77409
Position
complement(1751277..1752062)
Genome map
AA seq 261 aa AA seqDB search
MNPSQHAEQFQSQLANYVPQFTPEFWPVWLIIAGVLLVGMWLVLGLHALLRARGVKKSAT
DHGEKIYLYSKAVRLWHWSNALLFVLLLASGLINHFAMVGATAVKSLVAVHEVCGFLLLA
CWLGFVLINAVGDNGHHYRIRRQGWLERAAKQTRFYLFGIMQGEEHPFPATTQSKFNPLQ
QVAYVGVMYGLLPLLLLTGLLCLYPQAVGDVFPGVRYWLLQTHFALAFISLFFIFGHLYL
CTTGRTPHETFKSMVDGYHRH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtcgcaacatgctgaacagtttcagagccagttagcgaactatgtgccacag
ttcactcccgaattttggccggtgtggttgatcattgccggagtattgctggttgggatg
tggttggtgctggggctgcatgccttgcttcgtgctcgtggcgtgaagaaatcagccacc
gatcatggtgagaagatttatctttacagcaaagcggtcagattatggcactggtcgaat
gcgttactctttgtattgttgctggccagtgggctgataaatcactttgcgatggtgggc
gcaactgcggttaaaagtctggttgcggtgcatgaagtttgcggatttttgttactggca
tgctggctcggctttgtgctgatcaatgccgttggggataatggtcaccactatcgcatt
cgtcgtcaggggtggctggaacgagcggcaaaacaaacgcgattttatttgtttggcatt
atgcagggggaagaacatcctttcccggcaacaacccagtctaaatttaatcccttacag
caggtcgcctatgttggtgtcatgtatggattgctgccgttgttactattgacggggctg
ctgtgtctctatccgcaagccgtgggagatgtgtttcctggcgtaagatactggttattg
cagacacattttgctctggcatttataagcctcttttttatcttcggtcatctttatctt
tgcaccacggggcgtacgccacacgaaacctttaaaagcatggtcgatggctatcaccgg
cactaa

DBGET integrated database retrieval system