KEGG   Escherichia coli K-12 W3110: JW1678
Entry
JW1678            CDS       T00068                                 

Gene name
ydiK
Definition
(GenBank) predicted inner membrane protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: AI-2E_transport DUF3169
Other DBs
NCBI-ProteinID: BAA15450
UniProt: P0AFS7
Position
1770788..1771900
AA seq 370 aa
MVNVRQPRDVAQILLSVLFLAIMIVACLWIVQPFILGFAWAGTVVIATWPVLLRLQKIMF
GRRSLAVLVMTLLLVMVFIIPIALLVNSIVDGSGPLIKAISSGDMTLPDLAWLNTIPVIG
AKLYAGWHNLLDMGGTAIMAKVRPYIGTTTTWFVGQAAHIGRFMVHCALMLLFSALLYWR
GEQVAQGIRHFATRLAGVRGDAAVLLAAQAIRAVALGVVVTALVQAVLGGIGLAVSGVPY
ATLLTVLMILSCLVQLGPLPVLIPAIIWLYWTGDTTWGTVLLVWSGVVGTLDNVIRPMLI
RMGADLPLILILSGVIGGLIAFGMIGLFIGPVLLAVSWRLFAAWVEEVPPPTDQPEEILE
ELGEIEKPNK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtaaatgttcgtcagcccagggatgtcgcacaaattctgctttcggtgctgttttta
gccatcatgattgtggcatgtctgtggattgttcaaccctttattctcggctttgcatgg
gccggtacggtggttatcgccacctggccggtattgttacgtttgcaaaagatcatgttt
ggccgccgctctctcgccgttctggtgatgacgctgttattagtgatggtgtttatcatc
cctattgctttgctggttaacagtatcgtcgacggcagcggcccgctaattaaagccatt
tccagcggtgacatgacgttacccgatctggcgtggcttaataccattccggtgattggc
gcgaagctgtatgcaggctggcacaacttgctggatatgggggggacggcgatcatggcg
aaagtccgcccttatattggcaccaccaccacctggttcgttgggcaggcggcgcatatc
gggcgctttatggtgcattgtgcgctgatgcttctcttcagtgccctgctgtactggcgc
ggtgaacaggtggcacaaggcattcgccattttgcaacccgtctggcaggcgttcgcgga
gatgccgccgtgctgctggcggcacaggctatccgcgcggtggcgctgggtgtggtggtg
acggcgttagtacaggcagtgcttggcggtatcggcctcgccgtatccggcgtaccttat
gcaacgttgctaacggtgttaatgatcctctcctgccttgtccagcttggcccgttgccg
gtactgattccggcgattatctggctctactggactggcgataccacctggggaacggta
ttgttagtgtggagcggtgtggttggcacgctggataacgtcatccgcccaatgttaatt
cgcatgggtgccgatttaccgctgatcctgattctctctggcgttattggtggtttgatt
gctttcgggatgatcggtctgtttattggtccggttctgttagccgtttcctggcgtctg
tttgccgcgtgggtggaagaagtcccgccgccgacggaccaaccggaagaaattctcgaa
gaacttggcgaaatcgagaaaccgaataagtaa

DBGET integrated database retrieval system