KEGG   Escherichia coli K-12 W3110: JW1698Help
Entry
JW1698            CDS       T00068                                 

Gene name
nlpC
Definition
(GenBank) predicted lipoprotein
  KO
K13695  probable lipoprotein NlpC
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecj01002]
    JW1698 (nlpC)
Peptidases and inhibitors [BR:ecj01002]
 Cysteine peptidases
  Family C40
   JW1698 (nlpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 DUF1175 CHAP
Motif
Other DBs
NCBI-ProteinID: BAA15476
UniProt: P23898
Position
complement(1793981..1794445)
Genome map
AA seq 154 aa AA seqDB search
MRFCLILITALLLAGCSHHKAPPPNARLSDSITVIAGLNDQLQSWHGTPYRYGGMTRRGV
DCSGFVVVTMRDRFDLQLPRETKQQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYD
TNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgccttattttgatcacagcactgcttctggccgggtgtagccaccataaa
gcaccgccgccaaatgccagactttctgattcgattaccgttattgccggtttgaacgac
cagctacaaagctggcatggcacgccgtatcgttatggtggcatgacgcggcgcggtgtg
gactgttcgggatttgtggttgtgacgatgcgcgatcgtttcgatttgcagctgccccgt
gaaaccaaacaacaagcctctattggcacgcaaattgataaagacgagttgctgccaggt
gacctggtctttttcaaaacggggtccggacaaaatggtttgcatgtaggtatttacgat
accaacaaccaatttatccacgcctctaccagcaagggagtgatgcgttcctcacttgat
aatgtctattggcagaaaaatttctggcaggcgagacgaatctag

DBGET integrated database retrieval system