KEGG   Escherichia coli K-12 W3110: JW1726Help
Entry
JW1726            CDS       T00068                                 

Gene name
chbC
Definition
(GenBank) N,N'-diacetylchitobiose-specific enzyme IIC component of PTS
  KO
K02761  PTS system, cellobiose-specific IIC component
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00500  Starch and sucrose metabolism
ecj02060  Phosphotransferase system (PTS)
Module
ecj_M00275  PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JW1726 (chbC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    JW1726 (chbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1726 (chbC)
Transporters [BR:ecj02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    JW1726 (chbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC
Motif
Other DBs
NCBI-ProteinID: BAA15518
UniProt: P17334
Position
complement(1821570..1822928)
Genome map
AA seq 452 aa AA seqDB search
MSNVIASLEKVLLPFAVKIGKQPHVNAIKNGFIRLMPLTLAGAMFVLINNVFLSFGEGSF
FYSLGIRLDASTIETLNGLKGIGGNVYNGTLGIMSLMAPFFIGMALAEERKVDALAAGLL
SVAAFMTVTPYSVGEAYAVGANWLGGANIISGIIIGLVVAEMFTFIVRRNWVIKLPDSVP
ASVSRSFSALIPGFIILSVMGIIAWALNTWGTNFHQIIMDTISTPLASLGSVVGWAYVIF
VPLLWFFGIHGALALTALDNGIMTPWALENIATYQQYGSVEAALAAGKTFHIWAKPMLDS
FIFLGGSGATLGLILAIFIASRRADYRQVAKLALPSGIFQINEPILFGLPIIMNPVMFIP
FVLVQPILAAITLAAYYMGIIPPVTNIAPWTMPTGLGAFFNTNGSVAALLVALFNLGIAT
LIYLPFVVVANKAQNAIDKEESEEDIANALKF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgttattgcatcgcttgaaaaggtactcctcccttttgcagttaaaatagga
aagcagccacacgttaatgcaatcaaaaatggctttattcgcttaatgccgttaaccctt
gcgggggccatgtttgtattaattaacaacgtttttctaagctttggggaggggtcgttt
ttttattccttaggtattcgcctcgacgcctcaaccattgaaacacttaatggtctgaaa
ggtattggcggcaacgtatataacggaacattaggaataatgtctttaatggcaccgttc
tttattggcatggcgctggcagaagagcgtaaagtcgatgcgctggcggctgggttgtta
tccgttgcagcatttatgaccgtcaccccatatagtgtcggtgaggcctatgcggttggt
gcaaactggttaggtggggcgaatatcatctccgggattattattggcctggtggtggca
gaaatgtttacctttattgtccgccgcaattgggtcattaaactgcccgacagcgtacct
gcttcagtatcgcgttccttctcggcattaattcccggctttattattctttccgtgatg
gggattattgcctgggcgttgaatacctggggcaccaacttccatcagatcattatggat
accatctcaaccccactggcatcgttgggtagcgtggtgggctgggcctatgtgatcttt
gttccactgctctggttcttcggtattcatggcgcgctggcgctgaccgcactggacaac
ggcattatgacgccgtgggcactggaaaatatcgcgacctatcagcaatatggttccgtc
gaagcggcgctggcagccggtaagaccttccatatctgggccaagccgatgctggactcc
tttattttccttgggggcagtggtgcgactttaggcctgatcctggctatctttatcgcc
tctcgccgtgctgattatcgtcaggtggcaaaactggcgctgccgtccggcatcttccag
attaacgaaccgattctgtttggtctgccaattatcatgaacccggtgatgtttatcccg
tttgtactggtacaaccgattctggcggcaatcaccctcgcagcgtactacatgggcatt
attcctccggtgaccaatattgcaccgtggaccatgccaaccggtctgggagccttcttt
aacaccaacggtagcgtcgccgcattgctggtcgcactcttcaaccttggcatcgcaacg
ttaatttatctgccctttgttgtggtggctaacaaagcacaaaatgcgattgataaagaa
gagagcgaagaagatatcgctaacgccctgaaattttaa

DBGET integrated database retrieval system