KEGG   Escherichia coli K-12 W3110: JW1752Help
Entry
JW1752            CDS       T00068                                 

Gene name
topB
Definition
(GenBank) DNA topoisomerase III
  KO
K03169  DNA topoisomerase III [EC:5.6.2.1]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW1752 (topB)
Enzymes [BR:ecj01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     JW1752 (topB)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Topoisomerases
   JW1752 (topB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_bac Toprim FYRC
Motif
Other DBs
NCBI-ProteinID: BAA15551
UniProt: P14294
Structure
PDB: 

Position
complement(1846713..1848674)
Genome map
AA seq 653 aa AA seqDB search
MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRYAR
WNLADLPIVPEKWQLQPRPSVTKQLNVIKRFLHEASEIVHAGDPDREGQLLVDEVLDYLQ
LAPEKRQQVQRCLINDLNPQAVERAIDRLRSNSEFVPLCVSALARARADWLYGINMTRAY
TILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFEVKAHIVTPADERFTAIW
QPSEACEPYQDEEGRLLHRPLAEHVVNRISGQPAIVTSYNDKRESESAPLPFSLSALQIE
AAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFAGRHAVMNAISVHAPDLLP
QPVVDPDIRNRCWDDKKVDAHHAIIPTARSSAINLTENEAKVYNLIARQYLMQFCPDAVF
RKCVIELDIAKGKFVAKARFLAEAGWRTLLGSKERDEENDGTPLPVVAKGDELLCEKGEV
VERQTQPPRHFTDATLLSAMTGIARFVQDKDLKKILRATDGLGTEATRAGIIELLFKRGF
LTKKGRYIHSTDAGKALFHSLPEMATRPDMTAHWESVLTQISEKQCRYQDFMQPLVGTLY
QLIDQAKRTPVRQFRGIVAPGSGGSADKKKAAPRKRSAKKSPPADEVGSGAIA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgtttattgccgaaaaaccgagtctggcgcgcgccattgctgatgtcctgccc
aaaccgcaccggaaaggcgatggctttatcgagtgcggtaatggtcaggtggtgacctgg
tgtatcggtcacctgcttgagcaggcgcagccagacgcctacgacagccgctatgcgcgc
tggaatcttgcggatttgccgattgtcccggaaaagtggcaattacagccccgaccctcc
gtgaccaaacaacttaacgtcatcaaacggttcctgcatgaagccagcgaaatcgttcac
gccggggacccggatcgtgaagggcaattgctggtggatgaagtgctggactatctgcaa
ctggcaccggaaaagcgccagcaggtacagcgttgcttgataaacgacctgaacccgcag
gcggttgagcgggcgatcgaccgtcttcgttccaacagtgagtttgtaccgctgtgcgtt
tctgcgctggcgcgagcgcgtgccgactggctgtacggcatcaatatgacccgtgcgtat
accattctcggtcgcaatgccggttatcagggcgtactttccgtgggacgcgtgcagacg
cccgtgcttgggctggtggtgcgccgcgatgaagagattgaaaacttcgtggcgaaagac
ttctttgaagtcaaagcacatatcgtgacacctgccgatgagcggtttaccgctatctgg
caaccgagcgaagcgtgtgaaccgtaccaggatgaagaagggcgcttgttacatcgtcca
ctggcggagcatgtggttaaccgcattagtggtcaaccggctattgtcaccagctataac
gataaacgggaatcagaatccgcgccgctgcctttttcgctttcagcgttgcagattgaa
gcggcaaaacgttttggtctgagtgcgcagaacgtgcttgatatctgccagaaactgtac
gaaacgcacaagctaatcacttatccgcgttctgattgtcgctatttgccagaagaacat
tttgccggacgccacgcggtgatgaatgccatcagtgttcatgcaccggatctgttgccg
cagccagtggtagatccagatatacgcaaccgctgttgggatgacaaaaaggtcgatgcg
caccacgccatcattccgaccgcacggagttctgcgatcaacctgacggagaacgaagcg
aaggtctataacctgattgcccgtcagtatctgatgcaattctgcccggatgcggtgttc
cgcaagtgtgttatcgaactggacattgccaaaggcaaatttgtcgctaaagcgcgtttt
cttgctgaagcaggctggcgcacgctgttaggcagcaaagagcgcgatgaagaaaacgac
ggcacgccactgcctgtggtggcgaaaggcgatgagttgctgtgtgaaaaaggtgaagtg
gtagagcggcaaacccagccgccgcgccattttaccgatgcaacactgctttcggcgatg
accgggatcgcgcgctttgtgcaggataaagatctgaaaaagatcctccgtgcgaccgat
ggtctggggacagaggcaacgcgtgccgggattattgaactgttgttcaagcgtggtttc
ctgaccaaaaaagggcgctatatccactccaccgacgccggaaaagcgctattccattcg
ctgccggagatggcgacgcgaccggacatgaccgcgcactgggaatcggtgctgacgcaa
atcagcgaaaagcagtgtcgctatcaggactttatgcagccgctggtggggacgctatat
cagcttattgatcaagccaaacgtacgccggtgcggcagtttcgcggcattgtggctccg
ggcagtggtggcagtgctgataagaaaaaggctgcaccgcgtaaacgtagtgcgaaaaaa
agtccgccagcagatgaagtcggaagcggggcgatagcgtaa

DBGET integrated database retrieval system