KEGG   Escherichia coli K-12 W3110: JW1771Help
Entry
JW1771            CDS       T00068                                 

Gene name
mipA
Definition
(GenBank) scaffolding protein for murein synthesizing machinery
  KO
K07274  MipA family protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1771 (mipA)
Transporters [BR:ecj02000]
 Other Transporters
  Others
   JW1771 (mipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MipA OMP_b-brl
Motif
Other DBs
NCBI-ProteinID: BAA15579
UniProt: P0A908
Position
complement(1867440..1868186)
Genome map
AA seq 248 aa AA seqDB search
MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFW
FRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQ
YGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKE
SARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLI
STGITYKF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaactcaaacttctggcacttggagtgcttatcgcaacgtctgcaggcgtagcg
cacgctgaaggtaaattttccctgggcgcaggcgtaggtgtcgttgaacacccatataaa
gattacgataccgatgtttacccagtaccggtaatcaactatgaaggcgataacttctgg
ttccgtggcttaggtggtggttactacctgtggaatgacgcaacggataaactttcaatt
accgcttactggtcgccgctttacttcaaagcgaaagacagtggcgatcaccaaatgcgt
cacctggatgaccgtaagagcaccatgatggctggtctgtcttatgctcactttacccag
tacggttacctgcgtaccaccctggctggcgataccctggataacagcaacggcatcgtc
tgggatatggcctggttgtatcgttacaccaacggtggcctgaccgtgactccgggtatt
ggtgtgcagtggaacagcgaaaaccagaacgaatactattatggcgtatcgcgcaaagag
tccgctcgcagcggtctgcgtggctataacccgaacgacagctggagcccttacctggag
ctgagcgccagctacaacttcctcggcgactggagtgtttacggtaccgcacgctacacc
cgtctgtctgatgaagttactgacagcccgatggtggataaatcctggactggcctgatt
tctaccgggatcacctacaaattctga

DBGET integrated database retrieval system