KEGG   Escherichia coli K-12 W3110: JW1787Help
Entry
JW1787            CDS       T00068                                 

Gene name
yeaS
Definition
(GenBank) neutral amino-acid efflux system
  KO
K11250  leucine efflux protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1787 (yeaS)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW1787 (yeaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE TerC
Motif
Other DBs
NCBI-ProteinID: BAA15593
UniProt: P76249
Position
complement(1881835..1882473)
Genome map
AA seq 212 aa AA seqDB search
MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL
AWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSEAKSDEPQYGAIFKRA
LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILAATLELVSFCYLSFLIISGAFVTQ
YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctgaatacggggttctgaattactggacctatctggttggggccatttttatt
gtgttggtgccagggccaaataccctgtttgtactcaaaaatagcgtcagtagcggtatg
aaaggcggttatcttgcggcctgcggtgtatttattggcgatgcggtattgatgtttctg
gcatgggctggagtggcgacattaattaagaccaccccgatattattcaacattgtacgt
tatcttggtgcgttttatttgctctatctggggagtaaaattctttacgcgaccctgaag
ggtaaaaatagcgaggccaaatccgatgagccccaatacggtgctatttttaaacgcgcg
ttaattttgagcctgactaatccgaaagccattttgttctatgtgtcgtttttcgtacag
tttatcgatgttaatgccccacatacgggaatttcattctttattctggcggcgacgctg
gaactggtgagtttctgctatttgagcttcctgattatatctggtgcttttgtcacgcag
tacatacgtaccaaaaagaaactggctaaagttggcaactcactgattggtttgatgttc
gtgggtttcgctgcccgactggcgacgctgcaatcctga

DBGET integrated database retrieval system