KEGG   Escherichia coli K-12 W3110: JW1831Help
Entry
JW1831            CDS       T00068                                 

Gene name
holE
Definition
(GenBank) DNA polymerase III, theta subunit
  KO
K02345  DNA polymerase III subunit theta [EC:2.7.7.7]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03030  DNA replication
ecj03430  Mismatch repair
ecj03440  Homologous recombination
Module
ecj_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    JW1831 (holE)
   03430 Mismatch repair
    JW1831 (holE)
   03440 Homologous recombination
    JW1831 (holE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW1831 (holE)
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW1831 (holE)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     JW1831 (holE)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     JW1831 (holE)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     JW1831 (holE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_theta MMM1 DUF3283
Motif
Other DBs
NCBI-ProteinID: BAA15650
UniProt: P0ABS8
Structure
PDB: 

Position
1926822..1927052
Genome map
AA seq 76 aa AA seqDB search
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHR
LASVNLSRLPYEPKLK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaatctggctaaactggatcaaacagaaatggataaagtgaatgtcgatttg
gcggcggccggggtggcatttaaagaacgctacaatatgccggtgatcgctgaagcggtt
gaacgtgaacagcctgaacatttgcgcagctggtttcgcgagcggcttattgcccaccgt
ttggcttcggtcaatctgtcacgtttaccttacgagcccaaacttaaataa

DBGET integrated database retrieval system