KEGG   Escherichia coli K-12 W3110: JW1841
Entry
JW1841            CDS       T00068                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00030  Pentose phosphate pathway
ecj00480  Glutathione metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
ecj01200  Carbon metabolism
Module
ecj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ecj_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ecj_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JW1841 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    JW1841 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecj04147]
    JW1841 (zwf)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     JW1841 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     JW1841 (zwf)
Exosome [BR:ecj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   JW1841 (zwf)
  Exosomal proteins of colorectal cancer cells
   JW1841 (zwf)
  Exosomal proteins of bladder cancer cells
   JW1841 (zwf)
SSDB
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Other DBs
NCBI-ProteinID: BAA15660
UniProt: P0AC53
Position
complement(1936553..1938028)
AA seq 491 aa
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTK
VVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGAMLDQKNRITINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcctgtgacctggtcattttcggcgcgaaaggcgac
cttgcgcgtcgtaaattgctgccttccctgtatcaactggaaaaagccggtcagctcaac
ccggacacccggattatcggcgtagggcgtgctgactgggataaagcggcatataccaaa
gttgtccgcgaggcgctcgaaactttcatgaaagaaaccattgatgaaggtttatgggac
accctgagtgcacgtctggatttttgtaatctcgatgtcaatgacactgctgcattcagc
cgtctcggcgcgatgctggatcaaaaaaatcgtatcaccattaactactttgccatgccg
cccagcacttttggcgcaatttgcaaagggcttggcgaggcaaaactgaatgctaaaccg
gcacgcgtagtcatggagaaaccgctggggacgtcgctggcgacctcgcaggaaatcaat
gatcaggttggcgaatacttcgaggagtgccaggtttaccgtatcgaccactatcttggt
aaagaaacggtgctgaacctgttggcgctgcgttttgctaactccctgtttgtgaataac
tgggacaatcgcaccattgatcatgttgagattaccgtggcagaagaagtggggatcgaa
gggcgctggggctattttgataaagccggtcagatgcgcgacatgatccagaaccacctg
ctgcaaattctttgcatgattgcgatgtctccgccgtctgacctgagcgcagacagcatc
cgcgatgaaaaagtgaaagtactgaagtctctgcgccgcatcgaccgctccaacgtacgc
gaaaaaaccgtacgcgggcaatatactgcgggcttcgcccagggcaaaaaagtgccggga
tatctggaagaagagggcgcgaacaagagcagcaatacagaaactttcgtggcgatccgc
gtcgacattgataactggcgctgggccggtgtgccattctacctgcgtactggtaaacgt
ctgccgaccaaatgttctgaagtcgtggtctatttcaaaacacctgaactgaatctgttt
aaagaatcgtggcaggatctgccgcagaataaactgactatccgtctgcaacctgatgaa
ggcgtggatatccaggtactgaataaagttcctggccttgaccacaaacataacctgcaa
atcaccaagctggatctgagctattcagaaacctttaatcagacgcatctggcggatgcc
tatgaacgtttgctgctggaaaccatgcgtggtattcaggcactgtttgtacgtcgcgac
gaagtggaagaagcctggaaatgggtagactccattactgaggcgtgggcgatggacaat
gatgcgccgaaaccgtatcaggccggaacctggggacccgttgcctcggtggcgatgatt
acccgtgatggtcgttcctggaatgagtttgagtaa

DBGET integrated database retrieval system