KEGG   Escherichia coli K-12 W3110: JW1869Help
Entry
JW1869            CDS       T00068                                 

Gene name
flhB
Definition
(GenBank) predicted flagellar export pore protein
  KO
K02401  flagellar biosynthetic protein FlhB
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    JW1869 (flhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecj02044]
    JW1869 (flhB)
   02035 Bacterial motility proteins [BR:ecj02035]
    JW1869 (flhB)
Secretion system [BR:ecj02044]
 Type III secretion system
  Flagellar export apparatus
   JW1869 (flhB)
Bacterial motility proteins [BR:ecj02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    JW1869 (flhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_export_2
Motif
Other DBs
NCBI-ProteinID: BAA15696
UniProt: P76299
Position
complement(1966757..1967905)
Genome map
AA seq 382 aa AA seqDB search
MSDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGML
SAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL
QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT
AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK
GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI
REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQRP
VQPTHLPVPEALDFINEKPTHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacgagagcgacgacaaaacagaagcccccacacctcaccgactagaaaaagcg
cgggaagaggggcaaatcccgcgttcccgtgaactgacctcactgctgattttgctggtg
ggcgttagtgttatctggtttggcggtgtgtcgctggcccgtcgattgtcgggcatgctc
tccgctgggctgcattttgatcacagtattatcaatgacccgaatctgatcctcgggcag
attattctgctgatcagagaagccatgctggcgctgctgccgctgattagcggcgtggtg
ctggtggcgctcatttctccggtcatgctgggagggctggtatttagcggcaaatccttg
cagccgaagttttccaaactcaacccgctaccgggcattaaacggatgttctcggctcag
actggcgcggagttgcttaaagcaattttgaaaaccatcctggttggcagcgtgacgggg
ttttttctctggcatcactggccgcagatgatgcgcttgatggccgagtctccgattacc
gccatgggtaatgcgatggatttggtagggctatgcgcactgctggtggtgcttggtgtc
attccaatggtgggatttgacgtctttttccaaatattcagccacctgaaaaagctgcgt
atgtcacggcaggatattcgtgatgagttcaaacaaagcgaaggtgaccctcatgttaaa
gggcggatccgtcagatgcagcgagctgctgcacggcgtcggatgatggccgatgtgccg
aaagcggatgtcattgtcaataacccgacccactattcggtagcgttgcagtatgacgaa
aacaaaatgagcgcaccgaaagtggtcgctaaaggtgcagggctggtcgcgctgcgcatt
cgtgaaattggcgctgaaaataacgtcccgacgcttgaagcgccgccgctggcgcgagcg
ctgtatcgacatgcggagattggtcaacaaatcccgggtcaactgtacgccgcggtggcg
gaagtgctggcctgggtctggcaactgaaacgctggcgtctggctggtggacagcgccct
gtacaacctactcatcttccggtgccggaagccctggattttattaacgagaaaccgacc
catgagtaa

DBGET integrated database retrieval system