KEGG   Escherichia coli K-12 W3110: JW1897Help
Entry
JW1897            CDS       T00068                                 

Gene name
pgsA
Definition
(GenBank) phosphatidylglycerophosphate synthetase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00564  Glycerophospholipid metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    JW1897 (pgsA)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     JW1897 (pgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: BAA15732
UniProt: P0ABF8
Position
complement(1994406..1994954)
Genome map
AA seq 182 aa AA seqDB search
MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST
RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS
VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL
DQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaatatccctacgttgcttacactgttccgtgtcatccttatcccattcttt
gtattggtcttttatctgcctgtcacctggtcgccgtttgccgccgcgctcattttctgc
gtcgcggcggtgactgactggttcgatggttttctggcacgccgctggaaccagagtacc
cggtttggtgctttccttgaccctgtggcagataaagttctcgtggctatcgccatggtg
ctggtaaccgagcattatcacagctggtgggtgacattaccggcggcaacgatgatcgcc
cgtgaaattattatttctgcgctacgcgaatggatggcggagttgggtaaacgcagtagc
gtggccgtctcctggattgggaaagtgaaaaccactgcccagatggtggcgttggcatgg
ctgctgtggcgtccgaacatttgggttgagtacgccggtattgcacttttctttgtggct
gcggtactgactctgtggtcaatgttgcaatatttgagcgctgcgcgtgcagatttgctt
gatcagtga

DBGET integrated database retrieval system