KEGG   Escherichia coli K-12 W3110: JW1903Help
Entry
JW1903            CDS       T00068                                 

Gene name
yecS
Definition
(GenBank) predicted transporter subunit
  KO
K10009  L-cystine transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Module
ecj_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW1903 (yecS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1903 (yecS)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    JW1903 (yecS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAA15738
UniProt: P0AFT2
Position
complement(1999948..2000616)
Genome map
AA seq 222 aa AA seqDB search
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE
AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagtatacaactggttattgattccttgccgttcctgctgaaaggggctggg
tatacgctgcaactcagtatcggcggcatgttttttggcttactgctcgggtttattctc
gcgctgatgcgtctgtcgccaatctggcccgtgcgctggctggcgcgtttttatatctct
atttttcgtggtacgccgctcatcgcacaactgtttatgatctattacggcctgccgcag
tttggtatcgaattagatcccattccgtcagcaatgattggtctgtcgttgaacactgcc
gcctatgctgccgaaacgctgcgcgccgccatttcttctattgataaaggtcagtgggaa
gcggcagccagtattggtatgacgccgtggcagaccatgcgtcgcgcgattttgccacag
gcggcgcgtgtggcgttgccgccgctgtcgaacagctttattagcctggtaaaagatacg
tcgctggccgcgacaatccaggtgccggagctgttccgtcaggcgcagttgattacctcg
cgtacgctggaggtgttcaccatgtatctggcggcttcgctcatctactggatcatggcg
actgtgttatcgacgttgcagaaccattttgagaatcaacttaatcgccaggagagagaa
ccaaaatga

DBGET integrated database retrieval system