KEGG   Escherichia coli K-12 W3110: JW1903
Entry
JW1903            CDS       T00068                                 

Symbol
yecS
Name
(GenBank) predicted transporter subunit
  KO
K10009  L-cystine transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW1903 (yecS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1903 (yecS)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    JW1903 (yecS)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAA15738
UniProt: P0AFT2
Position
complement(1999948..2000616)
AA seq 222 aa
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE
AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
NT seq 669 nt   +upstreamnt  +downstreamnt
atgcaagaaagtatacaactggttattgattccttgccgttcctgctgaaaggggctggg
tatacgctgcaactcagtatcggcggcatgttttttggcttactgctcgggtttattctc
gcgctgatgcgtctgtcgccaatctggcccgtgcgctggctggcgcgtttttatatctct
atttttcgtggtacgccgctcatcgcacaactgtttatgatctattacggcctgccgcag
tttggtatcgaattagatcccattccgtcagcaatgattggtctgtcgttgaacactgcc
gcctatgctgccgaaacgctgcgcgccgccatttcttctattgataaaggtcagtgggaa
gcggcagccagtattggtatgacgccgtggcagaccatgcgtcgcgcgattttgccacag
gcggcgcgtgtggcgttgccgccgctgtcgaacagctttattagcctggtaaaagatacg
tcgctggccgcgacaatccaggtgccggagctgttccgtcaggcgcagttgattacctcg
cgtacgctggaggtgttcaccatgtatctggcggcttcgctcatctactggatcatggcg
actgtgttatcgacgttgcagaaccattttgagaatcaacttaatcgccaggagagagaa
ccaaaatga

DBGET integrated database retrieval system