KEGG   Escherichia coli K-12 W3110: JW1965Help
Entry
JW1965            CDS       T00068                                 

Gene name
yeeO
Definition
(GenBank) predicted multidrug efflux system
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE
Motif
Other DBs
NCBI-ProteinID: BAA15804
UniProt: P76352
Position
complement(2060340..2061983)
Genome map
AA seq 547 aa AA seqDB search
MLRHILTAKNLLSNPIFKFPNCLPFLSTVCCICRQFVGENLCSFADSPSLFEMWFHFLQL
RSALNISSALRQVVHGTRWHAKRKSYKVLFWREITPLAVPIFMENACVLLMGVLSTFLVS
WLGKDAMAGVGLADSFNMVIMAFFAAIDLGTTVVVAFSLGKRDRRRARVATRQSLVIMTL
FAVLLATLIHHFGEQIIDFVAGDATTEVKALALTYLELTVLSYPAAAITLIGSGALRGAG
NTKIPLLINGSLNILNIIISGILIYGLFSWPGLGFVGAGLGLTISRYIGAVAILWVLAIG
FNPALRISLKSYFKPLNFSIIWEVMGIGIPASVESVLFTSGRLLTQMFVAGMGTSVIAGN
FIAFSIAALINLPGSALGSASTIITGRRLGVGQIAQAEIQLRHVFWLSTLGLTAIAWLTA
PFAGVMASFYTQDPQVKHVVVILIWLNALFMPIWSASWVLPAGFKGARDARYAMWVSMLS
MWGCRVVVGYVLGIMLGWGVVGVWMGMFADWAVRAVLFYWRMVTGRWLWKYPRPEPQKCE
KKPVVSE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaggcacatcttaacggcgaaaaatcttttgtcaaacccgatttttaaattcccc
aactgtttgccgtttctatcaacagtttgttgcatttgcagacaatttgttggcgaaaat
ctttgcagctttgctgattctccctcattatttgaaatgtggtttcactttctgcaatta
aggtcggctttgaatatctcctctgctttacgccaggttgttcacggcactcgctggcac
gctaaacgcaagagctacaaagtgttgttctggcgcgagataaccccgcttgctgttcct
atcttcatggagaatgcctgtgtcctgttgatgggggttctgagcacttttctggtcagc
tggctgggaaaagatgcgatggccggcgtgggattggcggacagcttcaatatggtcatt
atggctttttttgctgctatcgatcttggtactactgtcgttgtggcatttagtctcggt
aagcgggatcgacgacgagcgagggtggcgacgcggcagtcattggtgatcatgacgttg
tttgccgtactgttggcaacgcttattcatcattttggcgaacaaattattgatttcgtc
gcgggtgatgccacgacagaagttaaagcactggcgttgacttatctggagctgacggta
ctcagttatccagcagctgccatcactcttattggtagcggggcacttcgtggtgcaggg
aatacgaaaataccgctattgattaacggtagcctgaatattcttaatattattattagc
ggcatattgatttacggccttttctcctggccgggactgggatttgtcggggcagggctg
ggtttaaccatttctcgttatattggcgcagttgcaattttgtgggtgctggcgattggt
tttaatcctgcgctaaggatttcgttaaagagctattttaaaccgctgaattttagcatt
atctgggaagtcatggggattggtattcccgcgagtgtcgaatcagtgttatttaccagt
ggtcggttattaacccaaatgttcgttgccgggatggggaccagtgttattgccggaaat
tttatcgcgttttcaattgcggctcttatcaacttacccggaagtgcgctcggctctgct
tctacgatcattacaggccgaaggttgggggtagggcagatagcgcaagcagagattcag
ttgcggcatgtgttctggctttccactcttggattaacggccatcgcctggctaacggct
ccctttgccggggttatggcatcgttttacacccaggatccacaggttaaacatgtcgtt
gtgattctgatttggctaaatgctttatttatgcctatttggtccgcctcatgggtgcta
cccgctggatttaaaggtgctcgtgatgcccgttacgccatgtgggtttcgatgttgagc
atgtggggttgtcgggttgtagtcggttatgtgctgggaatcatgcttggctggggtgtg
gttggtgtctggatgggaatgtttgccgactgggctgtgcgggccgtgctgttttactgg
cgaatggttactggacgttggctatggaaataccctcgacccgagccgcaaaagtgtgaa
aaaaagccagttgtgtcggaataa

DBGET integrated database retrieval system