KEGG   Escherichia coli K-12 W3110: JW2008
Entry
JW2008            CDS       T00068                                 

Gene name
hisI
Definition
(GenBank) fused phosphoribosyl-AMP cyclohydrolase and phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-AMP cyclohydrolase / phosphoribosyl-ATP pyrophosphohydrolase [EC:3.5.4.19 3.6.1.31]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00340  Histidine metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01230  Biosynthesis of amino acids
Module
ecj_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    JW2008 (hisI)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     JW2008 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     JW2008 (hisI)
SSDB
Motif
Pfam: PRA-CH PRA-PH MazG Qua1
Other DBs
NCBI-ProteinID: BAA15858
UniProt: P06989
Position
2098751..2099362
AA seq 203 aa
MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQR
LWTKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQ
LLAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHL
LVLLQDQGLDLTTVIENLRKRHQ
NT seq 612 nt   +upstreamnt  +downstreamnt
atgttaacagaacaacaacgtcgcgaactggactgggaaaaaaccgacggacttatgccg
gtgattgtgcaacacgcggtatccggcgaagtgctaatgctgggctatatgaacccggaa
gccttagacaaaaccctcgaaagcggcaaagtcaccttcttctcgcgcactaaacagcga
ctgtggaccaaaggcgaaacgtcgggcaatttcctcaacgtagtgagtattgccccggac
tgcgacaacgacacgttactggtgctggcgaatcccatcggcccgacctgccacaaaggc
accagcagttgcttcggcgacaccgctcaccagtggctgttcctgtatcaactggaacaa
ctgctcgccgagcgcaaatctgccgatccggaaacctcctacaccgccaaactgtatgcc
agcggcaccaaacgcattgcgcagaaagtgggtgaagaaggcgtggaaaccgcgctggca
gcaacggtacatgaccgctttgagctgaccaacgaggcgtctgatttgatgtatcacctg
ctggtgttgttgcaggatcaggggctggatttaacgacggtaattgagaacctgcgtaaa
cggcatcagtga

DBGET integrated database retrieval system