KEGG   Escherichia coli K-12 W3110: JW2031Help
Entry
JW2031            CDS       T00068                                 

Gene name
wzxC
Definition
(GenBank) colanic acid exporter
  KO
K16695  lipopolysaccharide exporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2031 (wzxC)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW2031 (wzxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_3 Polysacc_synt Polysacc_synt_C DUF3153
Motif
Other DBs
NCBI-ProteinID: BAA15899
UniProt: P77377
Position
complement(2120817..2122295)
Genome map
AA seq 492 aa AA seqDB search
MSLREKTISGAKWSAIATVIIIGLGLVQMTVLARIIDNHQFGLLTVSLVIIALADTLSDF
GIANSIIQRKEISHLELTTLYWLNVGLGIVVCVAVFLLSDLIGDVLNNPDLAPLIKTLSL
AFVVIPHGQQFRALMQKELEFNKIGMIETSAVLAGFTCTVVSAHFWPLAMTAILGYLVNS
AVRTLLFGYFGRKIYRPGLHFSLASVAPNLRFGAWLTADSIINYLNTNLSTLVLARILGA
GVAGGYNLAYNVAVVPPMKLNPIITRVLFPAFAKIQDDTEKLRVNFYKLLSVVGIINFPA
LLGLMVVSNNFVPLVFGEKWNSIIPVLQLLCVVGLLRSVGNPIGSLLMAKARVDISFKFN
VFKTFLFIPAIVIGGQMAGAIGVTLGFLLVQIINTILSYFVMIKPVLGSSYRQYILSLWL
PFYLSLPTLVVSYALGIVLKGQLALGMLLAVQIATGVLAFVVMIVLSRHPLVVEVKRQFC
RSEKMKMLLRAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcttacgtgaaaaaaccatcagcggcgcgaagtggtcggcgattgccacggtgatc
atcatcggcctcgggctggtgcagatgaccgtgctggcgcggattatcgacaaccaccag
ttcggcctgcttaccgtgtcgctggtgattatcgcgctggcagatacgctttctgacttc
ggtatcgctaactcgattattcagcgaaaagaaatcagtcaccttgaactcaccacgttg
tactggctgaacgtcgggctggggatcgtggtgtgcgtggcggtgtttttgttgagtgat
ctcatcggcgacgtgctgaataacccggacctggcaccgttgattaaaacattatcgctg
gcgtttgtggtaatcccccacgggcaacagttccgcgcgttgatgcaaaaagagctggag
ttcaacaaaatcggcatgatcgaaaccagcgcggtgctggcgggcttcacttgtacggtg
gttagcgcccatttctggccgctggcgatgaccgcgatcctcggttatctggtcaatagt
gcggtgagaacgctgctgtttggctactttggccgcaaaatttatcgccccggtctgcat
ttctcgctggcgtcggtggcaccgaacttacgctttggtgcctggctgacggcggacagc
atcatcaactatctcaataccaacctttcaacgctcgtgctggcgcgtattctcggcgcg
ggcgtggcagggggatacaacctggcgtacaacgtggccgttgtgccaccgatgaagctg
aacccaatcatcacccgcgtgttgtttccggcattcgccaaaattcaggacgataccgaa
aagctgcgtgttaacttctacaagctgctgtcggtagtggggattatcaactttccggcg
ctgctcgggctaatggtggtgtcgaataactttgtaccgctggtctttggtgagaagtgg
aacagcattattccggtgctgcaattgctgtgtgtggtgggtctgctgcgctccgtaggt
aacccgattggttcgctgctgatggcgaaagcgcgggtcgatatcagctttaaattcaac
gtattcaaaacatttctgtttattccggcgattgttataggtgggcagatggcgggcgcg
atcggcgtcacgcttggcttcctgctggtgcaaattatcaacaccattctgagttacttc
gtgatgattaaaccggttcttggttccagttatcgccagtacatcctgagtttatggctg
ccgttttatctctcgctgccgacgctggtggtcagttatgcgctgggcattgtgctgaaa
gggcaactggcgctggggatgctgctggcggtgcaaatagccacgggggtgctggcgttt
gtggtgatgattgtgctgtcgcgccatccgctggtggtggaagtgaagcgtcagttttgt
cgcagcgaaaaaatgaaaatgcttttacgggcggggtga

DBGET integrated database retrieval system