KEGG   Escherichia coli K-12 W3110: JW2100
Entry
JW2100            CDS       T00068                                 

Gene name
mrp
Definition
(GenBank) antiporter inner membrane protein
  KO
K03593  ATP-binding protein involved in chromosome partitioning
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecj03036]
    JW2100 (mrp)
   03029 Mitochondrial biogenesis [BR:ecj03029]
    JW2100 (mrp)
Chromosome and associated proteins [BR:ecj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    JW2100 (mrp)
Mitochondrial biogenesis [BR:ecj03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    JW2100 (mrp)
SSDB
Motif
Pfam: ParA CbiA AAA_31 MipZ Fer4_NifH ArsA_ATPase VirC1 FeS_assembly_P CBP_BcsQ AAA_25 CLP1_P MeaB DUF563
Other DBs
NCBI-ProteinID: BAE76591
UniProt: P0AF08
Position
complement(2196393..2197502)
AA seq 369 aa
MNEQSQAKSPEALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWH
SAFEELKEQCSAELLRITGAKAIDWKLSHNIATLKRVKNQPGINGVKNIIAVSSGKGGVG
KSSTAVNLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLAT
NSIGYLVTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPV
TGAVVVTTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEK
LAEKYHTQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRVAAQLYWQGEVI
PGEISFRAV
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaacgaacaatcccaggccaaatcaccagaagccttgcgcgcaatggtcgccgggaca
ctggccaattttcagcacccaaccctgaagcataacctcaccacgctgaaagcgttgcac
catgtcgcctggatggacgacacgttgcatgtggaactggttatgccgtttgtctggcat
agcgcgttcgaagagttaaaagagcaatgtagcgccgaactgctgcgcatcaccggggcg
aaagctatcgactggaaactgtcgcataacatagccactctgaaacgcgtgaagaatcag
ccgggaattaacggtgtgaagaacattatcgcggtgagttccggtaaaggcggcgtgggt
aaatcgtccacggcggtaaacctggcactggcgctggcggcagaaggggcgaaagtcggc
attctggacgccgatatctacggcccatcaatcccaacaatgttgggcgcagaaaatcag
cgtccaacttcgccggacggtacccatatggcaccgattatgtctcatggcctggcaacc
aattcaattggttatctggtcactgacgacaatgcgatggtgtggcgtggaccgatggcg
agcaaggcgttaatgcagatgttgcaggaaaccttgtggccggatctcgactatctggtg
cttgatatgccgccaggcaccggtgacattcaattgacgctggcgcaaaacattccagta
accggtgcagtcgtggtcaccaccccgcaggacatcgcgctgatcgatgcgaaaaaaggc
attgtgatgttcgagaaagtcgaggttccggtgctcggtattgtcgagaacatgagtgtg
catatttgcagtaactgtggtcaccatgaaccgattttcggtaccggtggtgcagagaaa
ctggctgaaaaataccatacacagctgctggggcagatgccgttacacatctccttacgt
gaggatctcgataaaggtacgccaacggttatcagccgtccggagagcgaatttaccgct
atctaccgccagctggctgaccgcgttgcagctcagctctactggcagggtgaagtcatt
ccaggcgagatttccttccgcgcggtctaa

DBGET integrated database retrieval system