KEGG   Escherichia coli K-12 W3110: JW2139Help
Entry
JW2139            CDS       T00068                                 

Gene name
yeiB
Definition
(GenBank) conserved inner membrane protein
  KO
K07148  uncharacterized protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    JW2139 (yeiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF418
Motif
Other DBs
NCBI-ProteinID: BAE76629
UniProt: P25747
Position
complement(2245144..2246301)
Genome map
AA seq 385 aa AA seqDB search
MERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWYGAITPRDAWTWAFLDLIGQVK
FLTLFALLFGAGLQMLLPRGRRWIQSRLTLLVLLGFIHGLLFWDGDILLAYGLVGLICWR
LVRDAPSVKSLFNTGVMLYLVGLGVLLLLGLISDSQTSRAWTPDASAILYEKYWKLHGGV
EAISNRADGVGNSLLALGAQYGWQLAGMMLIGAALMRSGWLKGQFSLRHYRRTGFVLVAI
GVTINLPAIALQWQLDWAYRWCAFLLQMPRELSAPFQAIGYASLFYGFWPQLSRFKLVLA
IACVGRMALTNYLLQTLICTTLFYHLGLFMHFDRLELLAFVIPVWLANILFSVIWLRYFR
QGPVEWLWRQLTLRAAGPAISKTSR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaacgtcacgctcgattttgttcgcggcgtcgccattctggggatcctgcta
ttaaacatcagcgcctttgggctaccaaaggcggcttatctcaatcccgcctggtacggt
gctattacgccgcgggatgcatggacttgggcatttcttgatctcatcggccaggtgaaa
ttcctcacgctttttgcgctactgtttggtgcgggcctgcaaatgttgctgccccgtggc
agacgctggatccagtcgcggttaacgctgttagtcttgttgggctttattcacggttta
ttgttctgggacggcgatattttgctggcttacgggctggtgggcttaatctgctggcgg
ctggtgcgcgatgcgccatcggtaaaaagcctgtttaatacaggcgtcatgctttatctg
gtggggcttggcgttttgctgttattggggctgatttccgacagccagaccagccgcgcc
tggacgccggatgcatcggctattttgtatgaaaaatactggaagcttcacggcggcgtt
gaagcgatcagtaatcgtgccgatggtgttggcaacagtttactggcactgggcgcacag
tatggctggcaactggcagggatgatgctcattggtgcggcgctgatgcgcagcggctgg
ctgaaagggcagttcagcttacgtcactatcgtcgtactggttttgtgctggtggcgatt
ggggtgaccattaaccttcctgccatcgccctgcaatggcagctggactgggcgtatcgc
tggtgtgccttcttacttcaaatgccgcgggaactgagtgcgccgtttcaggcgattggc
tatgcgtcgctgttttatggcttctggccgcaattgagccgctttaagctggtgcttgcg
atcgcctgcgtcggacggatggcgctgaccaactatctattgcaaacgctgatttgtacc
acgcttttttaccacctcggtttgtttatgcattttgaccgcctggagctgctggcgttt
gttattccggtatggctggcgaatatcctcttctctgttatctggctgcgttacttccgc
caggggccggtggaatggctctggcgtcagttaactttgcgtgctgccggaccggcaata
tctaaaacatcaagataa

DBGET integrated database retrieval system