KEGG   Escherichia coli K-12 W3110: JW2145
Entry
JW2145            CDS       T00068                                 

Symbol
yeiH
Name
(GenBank) conserved inner membrane protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: Cons_hypoth698 DUF2231 LIDHydrolase
Other DBs
NCBI-ProteinID: BAE76635
UniProt: P62723
Position
2253051..2254100
AA seq 349 aa
MTNITLQKQHRTLWHFIPGLALSAVITGVALWGGSIPAVAGAGFSALTLAILLGMVLGNT
IYPHIWKSCDGGVLFAKQYLLRLGIILYGFRLTFSQIADVGISGIIIDVLTLSSTFLLAC
FLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIFGTVAIFL
YPAIYPLMSQWFSPETFGIYIGSTVHEVAQVVAAGHAISPDAENAAVISKMLRVMMLAPF
LILLAARVKQLSGANSGEKSKITIPWFAILFIVVAIFNSFHLLPQSVVNMLVTLDTFLLA
MAMAALGLTTHVSALKKAGAKPLLMALVLFAWLIVGGGAINYVIQSVIA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacgaatatcaccttacagaaacaacatcgtacactgtggcattttattccggggtta
gccctgagtgcagttatcaccggggtcgccctgtggggtggttccattcccgcggttgcg
ggtgccgggtttagtgccctcaccctcgcaatcttgttggggatggttttaggcaacacc
atctatccgcacatctggaaaagctgtgacggtggtgtgctgtttgccaagcaatattta
ttacgtctgggtatcattctttatggcttccgtctgacgttctcgcaaattgccgatgtc
ggtatcagtgggatcatcattgacgtgttgacgctgtccagtaccttcctgctggcttgc
ttcctggggcagaaagtgtttggtctggataagcacaccagctggttgatcggtgccggt
agcagtatctgtggtgctgccgcggtactggcgactgagccggtagtgaaagcggaagcc
agtaaagtaaccgtggctgttgcaaccgttgttatcttcgggaccgtcgcgattttcctc
tacccggcgatatatccgctgatgtctcaatggtttagtccggaaactttcggtatctac
attggttctactgtgcacgaagtggcgcaggtggtggcggcaggtcatgccatcagcccg
gatgcggaaaacgcagcagttatttccaaaatgctgcgcgtgatgatgctggctccgttc
ctcatcctgctggcggcgcgtgttaaacagctgtctggggcgaacagcggcgagaaaagc
aaaatcactattccgtggtttgccatcttgttcatcgtagttgccatctttaactcgttc
cacctgttaccgcagagcgtggtgaacatgctggtaacgctggataccttcctgctggca
atggcgatggcggcgctgggtctgaccactcacgtcagcgcgctgaaaaaagctggggcg
aaacctctgctgatggcactggtactgtttgcctggctgattgttggtggtggtgcgatt
aactatgtgattcaaagcgtcatcgcataa

DBGET integrated database retrieval system