KEGG   Escherichia coli K-12 W3110: JW2163
Entry
JW2163            CDS       T00068                                 

Gene name
spr
Definition
(GenBank) predicted peptidase, outer membrane lipoprotein
  KO
K13694  murein DD-endopeptidase / murein LD-carboxypeptidase [EC:3.4.-.- 3.4.17.13]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecj01002]
    JW2163 (spr)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecj01011]
    JW2163 (spr)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     JW2163 (spr)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     JW2163 (spr)
Peptidases and inhibitors [BR:ecj01002]
 Cysteine peptidases
  Family C40
   JW2163 (spr)
Peptidoglycan biosynthesis and degradation proteins [BR:ecj01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   JW2163 (spr)
SSDB
Motif
Pfam: NLPC_P60 Peptidase_C92 LRAT DHQS CHAP DUF1287
Other DBs
NCBI-ProteinID: BAA15983
UniProt: P0AFV4
Structure
PDB: 
2K1G

Position
2273313..2273879
AA seq 188 aa
MVKSQPILRYILRGIPAIAVAVLLSACSANNTAKNMHPETRAVGSETSSLQASQDEFENL
VRNVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEM
GKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNE
ARRVLSRS
NT seq 567 nt   +upstreamnt  +downstreamnt
atggtcaaatctcaaccgattttgagatatatcttgcgcgggattcccgcgattgcagta
gcggttctgctttctgcatgtagtgcaaataacaccgcaaagaatatgcatcctgagaca
cgtgcagtgggtagtgaaacatcatcactgcaagcttctcaggatgaatttgaaaacctg
gttcgtaatgtcgacgtaaaatcgcgaattatggatcagtatgctgactggaaaggcgta
cgttatcgtctgggcggcagcactaaaaaaggtatcgattgttctggtttcgtacagcgt
acattccgtgagcaatttggcttagaacttccgcgttcgacttacgaacagcaggaaatg
ggtaaatctgtttcccgcagtaatttgcgtacgggtgatttagttctgttccgtgccggt
tcaacgggacgccatgtcggtatttatatcggcaacaatcagtttgtccatgcttccacc
agcagtggtgttattatttccagcatgaatgaaccgtactggaagaagcgttacaacgaa
gcacgccgggttctcagccgcagctaa

DBGET integrated database retrieval system