KEGG   Escherichia coli K-12 W3110: JW2167Help
Entry
JW2167            CDS       T00068                                 

Gene name
yejE
Definition
(GenBank) predicted oligopeptide transporter subunit
  KO
K13895  microcin C transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Module
ecj_M00349  Microcin C transport system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW2167 (yejE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2167 (yejE)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349]
    JW2167 (yejE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-ProteinID: BAA15987
UniProt: P33915
Position
2278607..2279632
Genome map
AA seq 341 aa AA seqDB search
MSRLSPVNQARWARFRHNRRGYWSLWIFLVLFGLSLCSELIANDKPLLVRYDGSWYFPLL
KNYSESDFGGPLASQADYQDPWLKQRLENNGWVLWAPIRFGATSINFATNKPFPSPPSRQ
NWLGTDANGGDVLARILYGTRISVLFGLMLTLCSSVMGVLAGALQGYYGGKVDLWGQRFI
EVWSGMPTLFLIILLSSVVQPNFWWLLAITVLFGWMSLVGVVRAEFLRTRNFDYIRAAQA
LGVSDRSIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQG
KNNLQAPWLGITAFLSVAILLSLLIFIGEAVRDAFDPNKAV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgactcagccccgtcaatcaggcccgttgggcgcgttttcgtcataaccgtcgc
ggctactggtcgttatggattttcctcgtcttgtttggtttgagtttgtgttctgaactt
atcgccaacgataaaccgttgctggtgcgttatgacggcagttggtatttcccgttattg
aaaaactacagcgaaagcgattttggcggcccgctggcaagtcaggctgattatcaggac
ccgtggctgaaacaacggctggaaaataacggctgggtactgtgggcaccgattcgcttt
ggtgctaccagtatcaactttgctaccaataagcccttcccttctccaccctcccggcaa
aactggctgggaacggatgccaacggcggcgatgtgctggcacgcattctctatggcacg
cggatctcggttctgtttggcctgatgctgactctctgttccagcgtgatgggcgtgctg
gcgggggcgctacaaggctattacggcggtaaagtcgatctctggggacaacgctttatt
gaagtatggtcggggatgccgacgctgtttttgattattttactttccagcgtcgtacag
cctaacttctggtggctgctggcaattactgtcttgtttggctggatgagtctggtcggc
gtggtgcgggcggagtttttacgtactcgtaatttcgactacattcgtgcggcacaggcg
cttggcgtcagcgatcgcagtatcatcctgcgtcatatgttgcctaatgccatggtcgcg
accctcacctttttaccgtttattttatgtagttcgataaccaccctgacctcgctcgat
ttcctcggcttcggtctaccgctcggttcaccgtcactcggtgaactgctgttacaaggg
aaaaataaccttcaggccccgtggcttgggatcaccgccttcttgtcggtggcgatatta
ttgtctttgctgatctttattggtgaagccgtccgcgacgcatttgatcctaataaggcg
gtgtag

DBGET integrated database retrieval system