KEGG   Escherichia coli K-12 W3110: JW2199
Entry
JW2199            CDS       T00068                                 

Gene name
yojI
Definition
(GenBank) fused predicted multidrug transport subunits and membrane component and ATP-binding component of ABC superfamily
  KO
K06159  multidrug/microcin transport system ATP-binding/permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW2199 (yojI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2199 (yojI)
Transporters [BR:ecj02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    JW2199 (yojI)
Motif
Pfam: ABC_tran AAA_21 ABC_membrane SMC_N AAA_16 AAA_15 AAA_29 Methyltransf_30 AAA_5 Zeta_toxin APS_kinase
Other DBs
NCBI-ProteinID: BAA15994
UniProt: P33941
Position
complement(2310306..2311949)
AA seq 547 aa
MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL
LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI
AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE
TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN
IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN
KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS
GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA
NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ
DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR
DAVARTA
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggaacttcttgtacttgtctggcggcagtatcgctggccatttatcagtgtgatggcg
ctaagcctcgccagtgcggcattaggcattggcttaattgcttttatcaatcagcgcctt
atcgaaacggcggataccagtctgctggtgttgccggagtttctgggattattgctgctg
ttgatggcagtcactctcggatcgcaactggcgctcaccactttggggcatcacttcgtt
taccgactgcgtagtgaatttatcaagcggattctggatactcacgtcgagcgcattgaa
caactcggtagcgcctcgttgctggcggggttaaccagcgatgtgcgcaatatcaccatt
gcttttgtgcgtctgccggaactggtgcaggggatcattctcactatcggttcagcggcg
tatctgtggatgctgtcgggcaaaatgttgctggtaacggctatctggatggcgatcacc
atctggggcggttttgtgctggtggcgcgggtgtacaaacatatggcgaccctgcgtgaa
accgaagacaagctgtacacggattttcaaactgtacttgaagggcgcaaagagctgact
ctgaaccgggaacgcgccgagtatgtgtttaacaacctctacattcctgatgcgcaagag
tatcgccaccatattattcgcgcagacaccttccatcttagtgccgtgaactggtcaaac
atcatgatgctgggcgcaatcggcctggtgttctggatggcgaacagcctcggttgggct
gataccaacgttgccgcgacctattcgttgacgcttttattcctgcgtacgccgctgctt
tcggcggttggcgcattgccgacgctgctgacggcgcaggtggcgtttaacaagctgaac
aaattcgcgctcgcgcctttcaaagcagagtttccgcgcccgcaggcgtttcccaactgg
caaacgctggagctgcgtaacgtgacgtttgcttatcaggataacgcgttttccgttggt
ccgattaatctcaccatcaaacgtggcgagctgctgtttctgattggcggcaacggtagc
ggaaaatcgacgctggcgatgttgttgacgggcttgtatcagccacaaagcggcgaaatc
ttgctggatggcaaacctgtcagcggcgaacaaccggaagattatcgcaaactgttttcg
gcagtgtttaccgatgtctggctgtttgatcaactgctggggccggagggtaaacccgct
aacccgcaactggttgagaagtggctggcgcagctgaaaatggctcataagcttgagtta
agcaacgggcgtattgttaacctgaagttatcaaaagggcagaaaaaacgcgtggcgctg
ttgctggcgctggcagaagaacgcgatattatcctgctggatgaatgggcggcggatcag
gatccacacttccgtcgtgagttttatcaggtgttgctgccgctgatgcaggagatgggt
aaaactattttcgctatcagtcatgatgatcattactttatccacgccgaccgcctgctg
gaaatgcgcaatgggcaacttagcgagctgacgggcgaagagcgcgatgccgcttcgcgt
gatgccgttgcccggacggcataa

DBGET integrated database retrieval system