KEGG   Escherichia coli K-12 W3110: JW2203
Entry
JW2203            CDS       T00068                                 

Symbol
ompC
Name
(GenBank) outer membrane porin protein C
  KO
K09475  outer membrane pore protein C
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj01501  beta-Lactam resistance
ecj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW2203 (ompC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    JW2203 (ompC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2203 (ompC)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW2203 (ompC)
SSDB
Motif
Pfam: Porin_1 Porin_4 DUF4562 DUF4912
Other DBs
NCBI-ProteinID: BAA15998
UniProt: P06996
Structure
Position
complement(2314980..2316083)
AA seq 367 aa
MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLG
FKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYD
VTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGE
GFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAE
TYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQ
SKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVA
LGLVYQF
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaaagttaaagtactgtccctcctggtcccagctctgctggtagcaggcgcagcaaac
gctgctgaagtttacaacaaagacggcaacaaattagatctgtacggtaaagtagacggc
ctgcactatttctctgacaacaaagatgtagatggcgaccagacctacatgcgtcttggc
ttcaaaggtgaaactcaggttactgaccagctgaccggttacggccagtgggaatatcag
atccagggcaacagcgctgaaaacgaaaacaactcctggacccgtgtggcattcgcaggt
ctgaaattccaggatgtgggttctttcgactacggtcgtaactacggcgttgtttatgac
gtaacttcctggaccgacgtactgccagaattcggtggtgacacctacggttctgacaac
ttcatgcagcagcgtggtaacggcttcgcgacctaccgtaacactgacttcttcggtctg
gttgacggcctgaactttgctgttcagtaccagggtaaaaacggcaacccatctggtgaa
ggctttactagtggcgtaactaacaacggtcgtgacgcactgcgtcaaaacggcgacggc
gtcggcggttctatcacttatgattacgaaggtttcggtatcggtggtgcgatctccagc
tccaaacgtactgatgctcagaacaccgctgcttacatcggtaacggcgaccgtgctgaa
acctacactggtggtctgaaatacgacgctaacaacatctacctggctgctcagtacacc
cagacctacaacgcaactcgcgtaggttccctgggttgggcgaacaaagcacagaacttc
gaagctgttgctcagtaccagttcgacttcggtctgcgtccgtccctggcttacctgcag
tctaaaggtaaaaacctgggtcgtggctacgacgacgaagatatcctgaaatatgttgat
gttggtgctacctactacttcaacaaaaacatgtccacctacgttgactacaaaatcaac
ctgctggacgacaaccagttcactcgtgacgctggcatcaacactgataacatcgtagct
ctgggtctggtttaccagttctaa

DBGET integrated database retrieval system