KEGG   Escherichia coli K-12 W3110: JW2243
Entry
JW2243            CDS       T00068                                 

Gene name
yfaY
Definition
(GenBank) conserved hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: MoCF_biosynth CinA CinA_KH
Other DBs
NCBI-ProteinID: BAA16073
UniProt: P77808
Position
complement(2367101..2368303)
AA seq 400 aa
MLKVEMLSTGDEVLHGQIVDTNAAWLADFFFHQGLPLSRRNTVGDNLDDLVTILRERSQH
ADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHEAWLKEMERYFHERGRVMAPSNRKQAE
LPASAEFINNPVGTACGFAVQLNRCLMFFTPGVPSEFKVMVEHEILPRLRERFSLPQPPV
CLRLTTFGRSESDLAQSLDTLQLPPGVTMGYRSSMPIIELKLTGPASEQQAMEKLWLDVK
RVAGQSVIFEGTEGLPAQISRELQNRQFSLTLSEQFTGGLLALQLSRAGAPLLACEVVPS
QEETLAQTAHWITERRANHFAGLALAVSGFENEHLNFALATPDGTFALRVRFSTTRYSLA
IRQEVCAMMALNMLRRWLNGQDIASEHGWIEVVESMTLSV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgttaaaagtggaaatgttatccaccggggatgaagtgttacacgggcaaatcgttgac
actaacgctgcctggctggccgattttttctttcatcaggggttgccattatctcgccgc
aatacggtgggggataaccttgatgacttagtcaccattcttcgcgaacgtagtcagcac
gccgatgtgctgatcgttaacggcgggctgggaccgaccagcgatgatttaagcgcactc
gccgctgcgacagcaaaaggtgaaggcctggtgctgcatgaagcctggctcaaagagatg
gaacgctatttccacgaacgtggacgagtaatggcaccgagcaaccgtaaacaagcggag
ctgcctgccagtgctgaatttatcaataacccggtaggcaccgcctgtggttttgccgtg
cagcttaatcgttgcctgatgttctttactcccggcgtaccgtcagaatttaaggtgatg
gtcgagcacgaaatcctgccgcgcctgcgcgagcgtttttctttaccgcagccgccggtt
tgtctgcgtttgactacttttggtcgttcggaaagcgatctggcacaaagcctggacact
ctacaactgccgccgggcgtaacaatgggctatcgctcctcaatgcctatcatcgaactg
aaactcaccggaccggcaagcgagcaacaggcgatggaaaaactgtggctggatgttaaa
cgtgttgccggacagagcgtgattttcgaaggcactgaaggactgcccgcgcagatcagt
cgcgaattgcaaaaccgccagttcagcctgacgttgagcgagcaattcaccggtggttta
ttggctttgcaactttctcgcgcaggtgctccattgctggcgtgtgaagtggttccttca
caggaggaaaccctggcgcaaactgcgcactggattacagaacggcgggccaaccatttt
gccgggctggcactggctgtttcgggtttcgagaacgagcatctcaactttgcgctagcc
acgccagacggcactttcgctctgcgtgtgcgtttcagcactacgcgctacagcctggct
atccgtcaggaagtgtgcgcaatgatggcactgaatatgctgcgccgttggttaaacggc
caggatatcgccagtgagcatggctggattgaggttgttgagtccatgaccttatctgtc
tga

DBGET integrated database retrieval system