KEGG   Escherichia coli K-12 W3110: JW2265
Entry
JW2265            CDS       T00068                                 
Symbol
yfbK
Name
(GenBank) conserved hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2265 (yfbK)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW2265 (yfbK)
SSDB
Motif
Pfam: DUF3520 vWF_A VWA VWA_2 VWA_3 Sec23_trunk
Other DBs
NCBI-ProteinID: BAE76678
UniProt: P76481
Position
complement(2388665..2390392)
AA seq 575 aa
MRNKNIIMLLMSSLILSGCGPQPENKESQQQQPSTPTEQQVLAAQQAAIKEAEQSAAAAK
ALAQQEVQQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNP
LATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDWDIKDKQSIPASKPIPF
AMRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLIDTSGSMISDERLPLIQSSL
KLLVKELREQDNIAIVTYAGDSRIALPSISGSHKAEINAAIDSLDAEGSTNGGAGLELAY
QQATKGFIKGGINRILLATDGDFNVGIDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEA
MMVRIADVGNGNYSYIDTLSEAQKVLNSEMRQMLITVAKDVKAQIEFNPAWVTEYRQIGY
EKRQLRVEHFNNDNVDAGDIGAGKHITLLFELTLNGQKASIDKLRYAPDNKLAKSDKTKE
LAWLKIRWKYPQGKESQLVEFPLGPTINAPSEDMRFRAAVAAYGQKLRGSEYLNNTSWQQ
IKQWAQQAKGEDPQGYRAEFIRLIELADGVTDISQ
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcgaaataaaaatataatcatgttgcttatgagtagtttgattttgtcaggatgtggg
ccgcaacctgagaataaggaaagtcagcaacaacaacccagtactcccacagagcagcaa
gtgcttgccgcgcagcaagctgcaataaaagaggctgagcaaagcgccgccgccgcgaaa
gccttggcccagcaagaagtgcaacaatattcagacaaacaggctttacaggggcgattg
caggaagcgccaacatttgcaagagcggctaaagcaaaagctacacatatcgcaaatcca
ggaaccgctcgctaccagcagttcgatgataatccggttaagcaggtagcgcaaaatccg
ttggcgacgtttagtcttgacgttgacactggcagttatgcgaatgtaaggcgtttcctc
aatcaagggctgttacctccgccagacgctgtgcgggtggaggagatagtcaattatttc
ccgtctgattgggatatcaaagacaaacaatctattccggcctctaagccaatacctttc
gctatgcgctacgaattggcacctgcaccatggaatgaacagcgaacattgctgaaagtt
gatatcctggcgaaagatcgcaaaagtgaagagttaccagcttctaatctggtctttctt
atcgacacttctggttcaatgatttctgatgaacgtttgccacttatccagtcttcgttg
aaattattggtcaaagaacttcgtgagcaggataacattgccatcgtgacctacgctggc
gactcccgtattgcattgccttctatctccgggagtcataaggcggaaattaatgccgca
attgattcgctggatgccgaaggcagtaccaatggcggtgccgggctggaactggcttat
cagcaggcgacgaaggggtttattaagggcggcatcaatcgcattttattagccactgac
ggtgactttaacgttggcattgacgatccaaaatcgattgaatcaatggtcaaaaaacag
cgggagtctggtgttactctgtcgacgtttggcgtggggaatagcaattacaacgaggca
atgatggtgcgaattgccgatgttggtaacggcaactacagctacattgataccctctct
gaagcgcagaaagtattgaatagtgaaatgcggcagatgttgattaccgtagcaaaagat
gtcaaagcgcaaattgagtttaaccccgcgtgggtaacggaataccgtcagattggttat
gaaaagcgccaacttcgggtggaacattttaataacgacaacgttgatgcaggggatata
ggcgcaggcaaacatataacgttgttattcgaattaacgctgaacgggcaaaaagcatca
attgataagttacgctatgccccggataacaaattagcgaaatcggacaaaacgaaagaa
ctggcctggttaaaaattcgctggaaatacccgcagggaaaagaaagtcagttagttgaa
ttcccgctggggccaacaataaacgcgccctctgaagatatgcgttttcgcgcagcagta
gctgcatatgggcaaaagttacgcggttctgaatacctgaacaatacctcctggcagcag
atcaaacagtgggctcagcaggcaaaaggggaagatccacagggttacagggcggaattt
attcgcctgattgaactggcggatggtgtgactgacatcagtcagtga

DBGET integrated database retrieval system