KEGG   Escherichia coli K-12 W3110: JW2307
Entry
JW2307            CDS       T00068                                 

Gene name
argT
Definition
(GenBank) lysine/arginine/ornithine transporter subunit
  KO
K10013  lysine/arginine/ornithine transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW2307 (argT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2307 (argT)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    JW2307 (argT)
SSDB
Motif
Pfam: SBP_bac_3 NMT1 Lig_chan-Glu_bd LPAM_1
Other DBs
NCBI-ProteinID: BAA16156
UniProt: P09551
Position
complement(2432455..2433237)
AA seq 260 aa
MKKSILALSLLVGLSTAASSYAALPETVRIGTDTTYAPFSSKDAKGDFVGFDIDLGNEMC
KRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAK
GSPIQPTLDSLKGKHVGVLQGSTQEAYANETWRSKGVDVVAYANQDLVYSDLAAGRLDAA
LQDEVAASEGFLKQPAGKDFAFAGSSVKDKKYFGDGTGVGLRKDDAELTAAFNKALGELR
QDGTYDKMAKKYFDFNVYGD
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattctcgctctgtctttgttagtcggtctctccacagcggcttccagc
tatgcggcgctaccggagacggtacgtatcggaaccgataccacctacgcaccgttctca
tcgaaagatgctaaaggtgattttgttggctttgatatcgatctcggtaacgagatgtgc
aaacggatgcaggtgaaatgtacctgggttgccagtgactttgacgcgctgatcccctca
ctgaaagcgaaaaaaatcgacgctattatttcgtcgctttccattaccgataaacgtcag
caggagattgccttctccgacaagctgtacgccgcagattctcgtttgattgcggccaaa
ggttcaccgattcagccaacgctggattcactgaaaggtaaacatgttggtgtgctgcag
ggatcaacccaggaagcttacgctaacgagacctggcgtagtaaaggcgtggatgtggtg
gcctatgccaaccaggatttggtctattccgatctggctgcaggacgtctggatgctgcg
ttacaagatgaagttgctgccagcgaaggattcctcaagcaacctgctggtaaagatttc
gcctttgctggctcatcagtaaaagacaaaaaatacttcggtgatggcaccggtgtaggg
ctacgtaaagatgatgctgaactgacggctgccttcaataaggcgcttggcgagctgcgt
caggacggcacctacgacaagatggcgaaaaagtatttcgactttaatgtctacggtgac
tga

DBGET integrated database retrieval system