KEGG   Escherichia coli K-12 W3110: JW2367Help
Entry
JW2367            CDS       T00068                                 

Gene name
evgS
Definition
(GenBank) hybrid sensory histidine kinase in two-component regulatory system with EvgA
  KO
K07679  two-component system, NarL family, sensor histidine kinase EvgS [EC:2.7.13.3]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW2367 (evgS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecj01001]
    JW2367 (evgS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecj02022]
    JW2367 (evgS)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     JW2367 (evgS)
Protein kinases [BR:ecj01001]
 Histidine kinases
  NarL family
   JW2367 (evgS)
Two-component system [BR:ecj02022]
 NarL family
  EvgS-EvgA (acid and drug tolerance)
   JW2367 (evgS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Response_reg HATPase_c HisKA Hpt HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: BAA16241
UniProt: P30855
Position
2489820..2493413
Genome map
AA seq 1197 aa AA seqDB search
MKFLPYIFLLCCGLWSTISFADEDYIEYRGISSNNRVTLDPLRLSNKELRWLASKKNLVI
AVHKSQTATLLHTDSQQRVRGINADYLNLLKRALNIKLTLREYADHQKAMDALAEGEVDI
VLSHLVTSPPLNNDIAATKPLIITFPALVTTLHDSMRPLTSPKPVNIARVANYPPDEVIH
QSFPKATIISFTNLYQALASVSAGHNDYFIGSNIITSSMISRYFTHSLNVVKYYNSPRQY
NFFLTRKESVILNEVLNRFVDALTNEVRYEVSQNWLDTGNLAFLNKPLELTEHEKQWIKQ
HPNLKVLENPYSPPYSMTDENGSVRGVMGDILNIITLQTGLNFSPITVSHNIHAGTQLSP
GGWDIIPGAIYSEDRENNVLFAEAFITTPYVFVMQKAPDSEQTLKKGMKVAIPYYYELHS
QLKEMYPEVEWIQVDNASAAFHKVKEGELDALVATQLNSRYMIDHYYPNELYHFLIPGVP
NASLSFAFPRGEPELKDIINKALNAIPPSEVLRLTEKWIKMPNVTIDTWDLYSEQFYIVT
TLSVLLVGSSLLWGFYLLRSVRRRKVIQGDLENQISFRKALSDSLPNPTYVVNWQGNVIS
HNSAFEHYFTADYYKNAMLPLENSDSPFKDVFSNAHEVTAETKENRTIYTQVFEIDNGIE
KRCINHWHTLCNLPASDNAVYICGWQDITETRDLINALEVEKNKAIKATVAKSQFLATMS
HEIRTPISSIMGFLELLSGSGLSKEQRVEAISLAYATGQSLLGLIGEILDVDKIESGNYQ
LQPQWVDIPTLVQNTCHSFGAIAASKSIALSCSSTFPEHYLVKIDPQAFKQVLSNLLSNA
LKFTTEGAVKITTSLGHIDDNHAVIKMTIMDSGSGLSQEEQQQLFKRYSQTSAGRQQTGS
GLGLMICKELIKNMQGDLSLESHPGIGTTFTITIPVEISQQVATVEAKAEQPITLPEKLS
ILIADDHPTNRLLLKRQLNLLGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFEL
TRKLREQNSSLPIWGLTANAQANEREKGLSCGMNLCLFKPLTLDVLKTHLSQLHQVAHIA
PQYRHLDIEALKNNTANDLQLMQEILMTFQHETHKDLPAAFQALEAGDNRTFHQCIHRIH
GAANILNLQKLINISHQLEITPVSDDSKPEILQLLNSVKEHIAELDQEIAVFCQKND
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttaccctatatttttcttctctgttgtggtctttggtcgaccataagtttc
gcagacgaagattacatcgaatatcgtggcatcagtagtaacaaccgtgtcacacttgat
ccactacgtctgagcaacaaggaattacgttggttagcgagcaaaaaaaatcttgtgatt
gcagtacataagtcccaaacggctacgttgttgcataccgattcgcagcaacgggttcgt
ggtattaatgctgattatttaaatcttttaaaaagagcgttaaatatcaaattaacactc
cgggaatacgcagatcatcaaaaagcaatggacgcgcttgcagaaggtgaagtcgatata
gtgttatcacatttagttacttcgccgcctcttaataatgacattgctgcaaccaaacca
ttgataattacctttccggcgctggtaaccacccttcacgactcaatgcgaccgcttacc
tcaccaaaaccagtaaatattgctcgggtagcaaattaccccccagacgaggtaattcat
caatcatttccaaaagcaacaattatctcttttacaaatttatatcaggcattagcatcc
gtctcagctgggcacaatgattactttattggtagtaacatcattaccagcagtatgatt
tcccgctatttcactcactccttaaatgtagtgaaatattataactcgccgcgtcaatat
aattttttcttgaccagaaaagaatctgtcattcttaatgaagtactcaatagatttgtt
gatgctttaacaaatgaagttcgctatgaagtatcacaaaattggcttgatacaggaaac
ctggcctttctgaacaaaccattagaactcactgaacatgaaaaacagtggattaagcag
catcccaatttaaaggtgctggaaaatccttactcgcccccctattctatgacggatgaa
aatggctcggttcggggcgttatgggggacattcttaatattattaccttgcaaacaggt
ttaaatttttctccgatcaccgtttcacacaatatccatgctggaacacagcttagcccc
ggaggatgggatataatacctggcgctatttatagtgaagatcgagaaaataatgtttta
tttgctgaagccttcataacaacgccttacgtttttgtcatgcaaaaagcgcctgacagt
gaacaaacattaaaaaaaggaatgaaagttgccattccatattattatgagctgcattcg
caattaaaagagatgtatccggaggttgaatggatacaggtcgataatgccagcgctgca
tttcacaaggttaaggaaggtgaacttgatgctctggtcgcgacacagctaaattcgcgt
tacatgatcgatcattactatcctaatgaactttatcattttcttattcctggcgttccg
aatgcatcgctttcgttcgcttttcctcgcggagaaccggaacttaaggatattattaat
aaagcactgaatgcaattcccccaagcgaagttctgcgcctgacggaaaaatggattaaa
atgcccaatgtgaccattgacacatgggacctatatagcgagcaattttatattgttacg
acattatccgttttattagttggcagtagccttttatggggattctacctgttacgctca
gttcgtcgtcgtaaagtcattcagggtgatttagaaaaccaaatatcattccgaaaagca
ctctcggattccttaccgaatccaacttatgttgtaaactggcaaggtaatgtcattagt
cataatagtgcttttgaacattatttcactgcggattactacaaaaatgcaatgttacca
ttagaaaacagtgactcaccctttaaagatgttttttctaatgcgcatgaagtcacagca
gaaacgaaagaaaatcgaacaatatacacacaggtatttgaaattgataatggcatcgag
aaaagatgcattaatcactggcatacattatgcaatcttcctgcaagtgacaatgcagta
tatatttgtggttggcaagatattactgaaacgcgtgatctaattaatgcactcgaggta
gaaaaaaataaagcgataaaggctaccgtagcaaaaagtcagtttctggcaacgatgagt
cacgaaataagaacaccaataagctctattatgggcttcctggaacttctgtcgggttct
ggtcttagcaaggagcaacgggtggaggcgatttcacttgcctacgccaccggacaatca
ctcctcggcttaattggtgaaatccttgatgtcgacaaaattgaatcgggtaactatcaa
cttcaaccacaatgggtcgatatccctactttagtccagaacacttgtcactctttcggt
gcgattgctgcaagcaaatcgatcgcattaagttgcagcagtacgtttcctgaacattac
ctggttaagatcgaccctcaggcgtttaagcaggtcttatcaaatttactgagtaatgct
ctcaaatttaccaccgagggggcagtaaaaattacgacctccctgggtcacattgatgac
aaccacgctgttatcaaaatgacgattatggattctggaagtggattatcgcaggaagaa
caacaacaactgtttaaacgctacagccaaacaagtgcaggtcgtcagcaaacaggttct
ggtttaggcttaatgatctgcaaagaattaattaaaaatatgcagggcgatttgtcatta
gaaagtcatccaggcataggaacaacatttacgatcacaatcccggtagaaattagccag
caagtggcgactgtcgaggcaaaagcagaacaacccatcacactacctgaaaagttgagc
atattaatcgcggatgatcatccgaccaacaggctattactcaaacgccagctaaatcta
ttaggatatgatgttgatgaagccactgatggtgtgcaagcgctacacaaagtcagtatg
caacattatgatctgcttattactgacgttaatatgccgaatatggatggttttgagttg
actcgcaaactccgtgagcaaaattcttccttacccatctgggggcttacagccaacgca
caggctaacgaacgtgaaaaagggttaagttgcggcatgaacttatgtttgttcaaaccg
ttgaccctggatgtactgaaaacacatttaagtcagttacaccaagttgcgcatattgca
cctcagtatcgccaccttgatatcgaagccctgaaaaataatacggcgaacgatctacaa
ctgatgcaggagattctcatgactttccagcatgaaacgcataaagatctacccgctgcg
tttcaagcactagaagctggcgataacagaactttccatcagtgtattcatcgcatccac
ggtgcggctaacatcctgaatttgcaaaagttgattaatattagccatcagttagaaata
acacctgtttcagatgacagtaagcctgaaattcttcagttgctgaactctgtaaaagaa
cacattgcagagctggaccaggagattgctgttttctgtcagaaaaatgactaa

DBGET integrated database retrieval system