KEGG   Escherichia coli K-12 W3110: JW2388Help
Entry
JW2388            CDS       T00068                                 

Gene name
mntH
Definition
(GenBank) manganese/divalent cation transporter
  KO
K03322  manganese transport protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2388 (mntH)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW2388 (mntH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nramp
Motif
Other DBs
NCBI-ProteinID: BAA16262
UniProt: P0A769
Position
complement(2516914..2518152)
Genome map
AA seq 412 aa AA seqDB search
MTNYRVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASFGYQLLWVVVWAN
LMAMLIQILSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEIIAMATDLAEFIGAAIGF
KLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLFVAAAYIVELIFSQPNLA
QLGKGMVIPSLPTSEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGSRQQRYSATKWDVA
IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYLTLQPLLSHAAATVFGLSLVAAGL
SSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTMLPSFIVILMGLDPTRILVMSQVLLSFGI
ALALVPLLIFTSDSKLMGDLVNSKRVKQTGWVIVVLVVALNIWLLVGTALGL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacgaactatcgcgttgagagtagcagcggacgggcggcgcgcaagatgaggctcgca
ttaatgggacctgcgttcattgcggcgattggttatatcgatcccggtaactttgcgacc
aatattcaggcgggtgctagcttcggctatcagctactgtgggttgtcgtttgggccaac
ctgatggcgatgctgattcagatcctctctgccaaactagggattgccaccggtaaaaat
ctggcggagcagattcgcgatcactatccgcgtcccgtagtgtggttctattgggttcag
gcagaaattattgcgatggcaaccgacctggcggaatttattggtgcggcgatcggtttt
aaactcattcttggtgtttcgttgttgcagggcgcggtgctgacggggatcgcgactttc
ctgattttaatgctgcaacgtcgcgggcaaaaaccgctggagaaagtgattggcgggtta
ctgttgtttgttgccgcggcttacattgtcgagttgattttctcccagcctaacctggcg
cagctgggtaaaggaatggtgatcccgagtttacctacttcggaagcggtcttcctggca
gcaggcgtgttaggggcgacgattatgccgcatgtgatttatttgcactcctcgctcact
cagcatttacatggcggttcgcgtcaacaacgttattccgccaccaaatgggatgtggct
atcgccatgactattgccggttttgtcaatctggcgatgatggctacagctgcggcggcg
ttccacttttccggtcatactggtgttgccgatcttgatgaggcttatctgacgctgcaa
ccgctgttaagccacgctgcggcaacggtctttggattaagcctggttgctgcggggctg
tcttcaacggtggtggggacactggcggggcaggtggtgatgcagggcttcattcgcttt
catatcccgctgtgggtgcgtcgtacagtcaccatgttgccgtcatttattgtcattctg
atgggattagatccgacacggattctggttatgagtcaggtactgttaagttttggtatc
gctctggcgctggttccactgctgattttcaccagtgacagcaagttgatgggcgatctg
gtgaacagcaaacgcgtaaaacagacaggctgggtgattgtggtgctggtcgtggcgctg
aatatctggttgttggtggggacggcgctgggattgtag

DBGET integrated database retrieval system