KEGG   Escherichia coli K-12 W3110: JW2397Help
Entry
JW2397            CDS       T00068                                 

Gene name
xapB
Definition
(GenBank) xanthosine transporter
  KO
K11537  MFS transporter, NHS family, xanthosine permease
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2397 (xapB)
Transporters [BR:ecj02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Nucleoside:H+ symporter (NHS) family [TC:2.A.1.10]
    JW2397 (xapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nuc_H_symport MFS_1_like MFS_1 LacY_symp
Motif
Other DBs
NCBI-ProteinID: BAA16274
UniProt: P45562
Position
complement(2528175..2529431)
Genome map
AA seq 418 aa AA seqDB search
MSIAMRLKVMSFLQYFIWGSWLVTLGSYMINTLHFTGANVGMVYSSKGIAAIIMPGIMGI
IADKWLRAERAYMLCHLVCAGVLFYAASVTDPDMMFWVMLVNAMAFMPTIALSNSVSYSC
LAQAGLDPVTAFPPIRVFGTVGFIVAMWAVSLLHLELSSLQLYIASGASLLLSAYALTLP
KIPVAEKKATTSLASKLGLDAFVLFKNPRMAIFFLFAMMLGAVLQITNVFGNPFLHDFAR
NPEFADSFVVKYPSILLSVSQMAEVGFILTIPFFLKRFGIKTVMLMSMVAWTLRFGFFAY
GDPSTTGFILLLLSMIVYGCAFDFFNISGSVFVEQEVDSSIRASAQGLFMTMVNGVGAWV
GSILSGMAVDYFSVDGVKDWQTIWLVFAGYALFLAVIFFFGFKYNHDPEKIKHRAVTH
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcgatgcgcttaaaggtaatgtcctttttgcaatattttatctgggggagc
tggctggttaccctcggctcttacatgattaatactcttcatttcaccggcgctaatgtt
ggcatggtttacagttccaaagggatcgccgcgattattatgcctggtataatggggatc
atcgcagacaaatggctgcgcgcagaacgtgcatacatgctgtgtcacctggtgtgtgcg
ggcgtacttttttatgcggcatccgtaactgatccggatatgatgttttgggtgatgtta
gtcaatgcgatggcgtttatgccgactattgcgttatcgaacagcgtctcttattcctgt
cttgcccaggcagggcttgacccggtgaccgctttcccgcccattcgcgtttttggtacg
gtggggttcattgtcgcgatgtgggcagtaagcctgctgcatctggaattgagtagtctg
cagctgtatatcgcgtccggtgcgtcattgctgctgtcggcttatgcgctgactttgccg
aagattccggttgcggagaaaaaagcgaccacatcgcttgccagcaagctgggtctggat
gccttcgtgctgtttaaaaatccacgcatggccatctttttcctctttgccatgatgctg
ggtgcggtactgcaaattaccaacgtttttggtaatccgttcctacatgatttcgcccgt
aacccggagtttgctgacagttttgtggtgaaatatccctccattttactgtcagtttca
cagatggcagaagtgggctttatactgactatcccattctttttaaagcgatttggcatt
aaaaccgtcatgctgatgagtatggtggcctggacgctgcgctttggcttcttcgcctat
ggcgatccgtcaacaaccggatttattttgctgctgctgtcgatgattgtttatggctgt
gcattcgatttcttcaatatttctggttcggtatttgtcgaacaggaagttgattccagc
attcgtgccagcgcgcaggggctctttatgaccatggtaaatggtgtcggcgcatgggtt
ggctcgattctgagtggcatggcagtagattacttttcggtggatggcgtaaaagactgg
caaactatctggctggtgtttgcaggatatgctctttttctcgcagtgatatttttcttt
gggtttaaatataatcatgaccctgaaaagataaagcatcgagcggtgactcattaa

DBGET integrated database retrieval system