KEGG   Escherichia coli K-12 W3110: JW2448Help
Entry
JW2448            CDS       T00068                                 

Gene name
talA
Definition
(GenBank) transaldolase A
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00030  Pentose phosphate pathway
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
ecj01130  Biosynthesis of antibiotics
ecj01200  Carbon metabolism
ecj01230  Biosynthesis of amino acids
Module
ecj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ecj_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JW2448 (talA)
Enzymes [BR:ecj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     JW2448 (talA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: BAA16339
UniProt: P0A867
Position
2577322..2578272
Genome map
AA seq 316 aa AA seqDB search
MNELDGIKQFTTVVADSGDIESIRHYHPQDATTNPSLLLKAAGLSQYEHLIDDAIAWGKK
NGKTQEQQVVAACDKLAVNFGAEILKIVPGRVSTEVDARLSFDKEKSIEKARHLVDLYQQ
QGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGR
IYDWYQARKPMDPYVVEEDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQILALTGCDR
LTIAPNLLKELQEKVSPVVRKLIPPSQTFPRPAPMSEAEFRWEHNQDAMAVEKLSEGIRL
FAVDQRKLEDLLAAKL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagttagacggcatcaaacagttcaccactgtcgtggcagacagcggcgatatt
gagtccattcgccattatcatccccaggatgccaccaccaatccttcgctgttactcaaa
gctgccggattatcacaatatgagcatttaatagacgatgctatcgcctggggtaaaaaa
aatggcaagacccaggaacaacaggtggtcgcagcgtgtgacaaactggcggtcaatttc
ggtgctgaaatcctcaaaatcgtacccggtcgcgtgtcaacagaagttgatgcacgcctc
tcttttgataaagaaaagagtattgagaaggcgcgccatctggtggacttgtatcagcaa
caaggcgttgagaaatcacgcattctgatcaagctggcttcgacctgggaaggaattcgc
gcggcagaagagctggaaaaagaaggtattaactgcaacctgacgctgctgttttctttt
gcacaggcacgggcctgtgcggaagcaggcgtttttctgatttcgccgtttgtcgggcgt
atttatgactggtatcaggcacgcaagccgatggacccgtatgtggtggaagaagatccg
ggcgttaaatcggtgcgcaatatctacgactactataagcaacaccactatgaaaccatt
gtgatgggcgcgagcttccgtcgcaccgaacaaatcctcgccttaaccggctgcgatcga
ctgactatcgcaccgaatttactgaaggagctgcaggaaaaagtttcgccagtggtacgt
aaattaatcccaccttctcagacgttcccacgcccagctcccatgagcgaagcggagttc
cgttgggagcacaatcaggatgcgatggcggtagaaaaactgtctgaaggcattcgtctg
ttcgccgttgatcaacgcaaactggaagatcttcttgccgccaaactataa

DBGET integrated database retrieval system