KEGG   Escherichia coli K-12 W3110: JW2477Help
Entry
JW2477            CDS       T00068                                 

Gene name
focB
Definition
(GenBank) predicted formate transporter
  KO
K03459  formate transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2477 (focB)
Transporters [BR:ecj02000]
 Other Transporters
  Pores ion channels [TC:1]
   JW2477 (focB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans
Motif
Other DBs
NCBI-ProteinID: BAA16381
UniProt: P77733
Position
2612590..2613438
Genome map
AA seq 282 aa AA seqDB search
MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAP
SSQALTHLVGGLCFTLGFILLAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGN
LAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTFTESVSLGIMCNLMVCLALWM
SYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPPPFWQLAHSSADN
FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQEP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaactctctttcgacttgcagttgagcgccagaaaagcggcaatcgctgaa
cggattgccgcccataaaattgcccgcagtaaagtgtcggtctttttaatggcgatgtcc
gctggcgtgtttatggcgatcggatttactttttacctttccgttatcgccgatgccccg
tcttcacaggcattaacccatctggtgggcggcctttgctttacactcggctttattttg
ctggcggtttgcggcaccagcctgttcacctcgtcggtaatgacggtgatggcaaaaagt
cggggcgttattagttggcgaacttggctgattaacgcacttctggtggcctgcggtaat
ctggcaggtattgcctgtttcagtttgttaatctggttttccgggctggtgatgagtgaa
aacgcgatgtggggagtcgcggttttacactgcgccgagggcaaaatgcatcatacattt
actgaatctgtcagcctcggcattatgtgcaatctgatggtttgcctggcgctgtggatg
agttattgcgggcgttcgttatgcgacaaaatcgtcgccatgattttgcccatcaccctg
tttgtcgccagtggctttgagcactgtatcgccaatttgtttgtgattccgttcgccatt
gccattcgccatttcgcccctccccccttctggcagctggcgcacagtagcgcagacaat
tttccggcactgacggtcagccattttattaccgccaatctgctcccggtgatgctgggt
aatattatcggcggtgcggtgctggtgagtatgtgttatcgggctatttatttacgtcag
gaaccctga

DBGET integrated database retrieval system