KEGG   Escherichia coli K-12 W3110: JW2513Help
Entry
JW2513            CDS       T00068                                 

Gene name
iscU
Definition
(GenBank) scaffold protein
  KO
K04488  nitrogen fixation protein NifU and related proteins
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    JW2513 (iscU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU_N
Motif
Other DBs
NCBI-ProteinID: BAA16423
UniProt: P0ACD4
Structure
PDB: 

Position
complement(2658559..2658945)
Genome map
AA seq 128 aa AA seqDB search
MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKT
YGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIAD
YKSKREAK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcttacagcgaaaaagttatcgaccattacgagaatccgcgtaacgtgggttccttt
gacaacaacgacgagaacgtcggcagcggcatggtgggggcaccggcctgtggcgacgtg
atgaagttgcagattaaagtcaacgatgaaggtatcattgaagacgcgcgttttaaaact
tacggctgcggttccgctatcgcttccagctccctggtcaccgaatgggtgaaagggaag
tctctcgacgaagcgcaggcgatcaaaaacaccgatattgctgaagaacttgaactgccg
ccggtgaaaattcactgttctattctggcagaagacgcgatcaaagccgccattgcggac
tataaaagcaaacgtgaagcaaaataa

DBGET integrated database retrieval system