KEGG   Escherichia coli K-12 W3110: JW2545Help
Entry
JW2545            CDS       T00068                                 

Gene name
yfhH
Definition
(GenBank) predicted DNA-binding transcriptional regulator
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS HTH_6 SIS_2 HTH_Crp_2 Ifi-6-16 MarR
Motif
Other DBs
NCBI-ProteinID: BAE76737
UniProt: P37767
Position
2697415..2698263
Genome map
AA seq 282 aa AA seqDB search
MNGLLRIRQRYQGLAQSDKKLADYLLLQPDTARHLSSQQLANEAGVSQSSVVKFAQKLGY
KGFPALKLALSEALASQPESPSVPIHNQIRGDDPLRLVGEKLIKENTAAMYATLNVNSEE
KLHECVTMLRSARRIILTGIGASGLVAQNFAWKLMKIGFNAAAVRDMHALLATVQASSPD
DLLLAISYTGVRRELNLAADEMLRVGGKVLAITGFTPNALQQRASHCLYTIAEEQATNSA
SISACHAQGMLTDLLFIALIQQDLELAPERIRHSEALVKKLV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcttacttcgtatccgtcagcgttaccaggggcttgcccagagtgataaaaaa
ctggcggattatctgctgctacaacctgatacggcgcgccatttaagctctcagcaactg
gccaacgaagccggagtcagtcagtccagcgtcgtgaagttcgcgcaaaaactcggctat
aaaggttttccggcgcttaagttggcgttgagtgaagcgctggcaagccagccggaatca
ccctccgtgcccattcataaccaaatccgcggtgatgatccgttacggctggtcggcgaa
aaactgattaaagaaaatactgccgctatgtacgcaacgctaaacgttaatagtgaagag
aaactgcatgaatgcgtaacaatgttgcgctctgcgcggcggataattctgaccggtatt
ggcgcttcgggtctggtggcgcaaaactttgcctggaagctgatgaagattggcttcaat
gctgccgcagtgcgcgatatgcatgcgctactcgcaacagtacaggcgtcgtcccctgac
gatctgttattagccatttcctacaccggtgtacgacgcgagttaaacctggcggcagat
gagatgctgcgagtgggcggaaaagtgctggcgattaccggctttactccgaatgccctg
caacagcgtgcttctcattgcctgtataccattgccgaagaacaagcgacaaacagtgct
tcaatctctgcttgtcacgctcagggaatgttaacggatttgctgttcattgcgctgatt
cagcaggatctggaactggcaccagaacgtattcgtcatagtgaagcgctggtgaaaaaa
ctggtctga

DBGET integrated database retrieval system