KEGG   Escherichia coli K-12 W3110: JW2556Help
Entry
JW2556            CDS       T00068                                 

Gene name
rseA
Definition
(GenBank) anti-sigma factor
  KO
K03597  sigma-E factor negative regulatory protein RseA
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ecj03021]
    JW2556 (rseA)
Transcription machinery [BR:ecj03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     JW2556 (rseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RseA_N RseA_C RskA
Motif
Other DBs
NCBI-ProteinID: BAE76748
UniProt: P0AFX7
Structure
PDB: 

Position
complement(2707410..2708060)
Genome map
AA seq 216 aa AA seqDB search
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM
AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH
YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY
ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagaacaactttccgctttaatggatggcgaaacgctggatagtgagctgctt
aacgaactggctcataacccagaaatgcagaaaacctgggaaagctatcacttaatccgt
gactcaatgcggggtgatactcccgaggtgctccatttcgatatctcttcacgcgtgatg
gccgccattgaagaagagccagtacgtcaaccggcgacattgatcccggaagcccagcct
gcgccgcatcaatggcagaaaatgccattctggcagaaagtacgtccgtgggcggcacag
cttacccaaatgggcgtagccgcatgcgtatcgcttgcagttatcgttggcgtccagcac
tataatggacaatctgaaacgtcccagcagcccgaaacgccggtatttaatacactgccg
atgatgggtaaagccagcccggtaagcctgggagtaccttctgaagcgaccgcaaacaat
ggtcaacagcagcaggtacaggagcagcgtcgtcgcattaatgcaatgttgcaggattac
gaactgcaacgccgactccactctgaacagcttcagtttgagcaggcgcaaacccagcaa
gccgctgtacaggtgccaggaattcaaactttaggaacgcaatcgcagtaa

DBGET integrated database retrieval system