KEGG   Escherichia coli K-12 W3110: JW2652
Entry
JW2652            CDS       T00068                                 

Symbol
proV
Name
(GenBank) glycine betaine transporter subunit
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:7.6.2.9]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW2652 (proV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2652 (proV)
Enzymes [BR:ecj01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     JW2652 (proV)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    JW2652 (proV)
SSDB
Motif
Pfam: ABC_tran CBS AAA_16 ABC_ATPase AAA_21 AAA_22 AAA_29 AAA_30 SMC_N AAA RsgA_GTPase AAA_18 BCA_ABC_TP_C DUF2802 Zeta_toxin AAA_33 DUF87
Other DBs
NCBI-ProteinID: BAA16542
UniProt: P14175
Position
2803471..2804673
AA seq 400 aa
MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIM
GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH
MTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALA
INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN
GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRTPNGLIRKTPGFGPRSAL
KLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDAQTPLSELL
SHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNNG
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcaattaaattagaaattaaaaatctttataaaatatttggcgagcatccacagcga
gcgttcaaatatatcgaacaaggactttcaaaagaacaaattctggaaaaaactgggcta
tcgcttggcgtaaaagacgccagtctggccattgaagaaggcgagatatttgtcatcatg
ggattatccggctcgggtaaatccacaatggtacgccttctcaatcgcctgattgaaccc
acccgcgggcaagtgctgattgatggtgtggatattgccaaaatatccgacgccgaactc
cgtgaggtgcgcagaaaaaagattgcgatggtcttccagtcctttgccttaatgccgcat
atgaccgtgctggacaatactgcgttcggtatggaattggccggaattaatgccgaagaa
cgccgggaaaaagcccttgatgcactgcgtcaggtcgggctggaaaattatgcccacagc
tacccggatgaactctctggcgggatgcgtcaacgtgtgggattagcccgcgcgttagcg
attaatccggatatattattaatggacgaagccttctcggcgctcgatccattaattcgc
accgagatgcaggatgagctggtaaaattacaggcgaaacatcagcgcaccattgtcttt
atttcccacgatcttgatgaagccatgcgtattggcgaccgaattgccattatgcaaaat
ggtgaagtggtacaggtcggcacaccggatgaaattctcaataatccggcgaatgattat
gtccgtaccttcttccgtggcgttgatattagtcaggtattcagtgcgaaagatattgcc
cgccggacaccgaatggcttaattcgtaaaacccctggcttcggcccacgttcggcactg
aaattattgcaggatgaagatcgcgaatatggctacgttatcgaacgcggtaataagttt
gtcggcgcagtctccatcgattcgcttaaaaccgcgttaacgcagcagcaaggtcttgat
gcggcgctgattgatgcgccgttagcagtcgatgcacaaacgcctcttagcgagttgctc
tctcatgtcggacaggcaccctgtgcggtgcccgtggtcgacgaggaccaacagtatgtc
ggcatcatttcgaaaggaatgctgctgcgcgctttagatcgtgagggggtaaataatggc
tga

DBGET integrated database retrieval system