KEGG   Escherichia coli K-12 W3110: JW2660Help
Entry
JW2660            CDS       T00068                                 

Gene name
emrA
Definition
(GenBank) multidrug efflux system
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
ecj  Escherichia coli K-12 W3110
Module
ecj_M00701  Multidrug resistance, efflux pump EmrAB
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2660 (emrA)
Transporters [BR:ecj02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   JW2660 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl Orf78
Motif
Other DBs
NCBI-ProteinID: BAA16547
UniProt: P27303
Position
2810083..2811255
Genome map
AA seq 390 aa AA seqDB search
MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGN
QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMI
NSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQ
YNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPT
TPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVR
STPVAVSTAREISLAPVNKLIDDIVKANAG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaatgcggagactcaaaccccgcagcaaccggtaaagaagagcggcaaacgt
aagcgtctgctcctccttctcaccttgctctttataattattgccgtagcgatagggatt
tattggtttttggtactgcgtcacttcgaagaaaccgatgacgcatacgtggcagggaat
caaattcaaattatgtctcaggtgtctggcagcgtgacgaaagtctgggccgataacacc
gattttgtaaaagaaggcgacgtgctggtcactctcgacccgacagatgctcgccaggcg
tttgaaaaagccaaaactgcactggcttccagcgttcgccaaacccaccagctgatgatt
aacagcaagcagttgcaggcgaatattgaggtgcagaaaatcgccctcgcgaaagcacaa
agcgactacaaccgccgtgtgccgctgggcaatgccaacctgattggtcgcgaagagctg
caacacgcccgcgacgccgtcaccagtgcccaggcgcaactggacgtcgcgattcaacaa
tacaatgccaatcaggcgatgattctggggactaaactggaagatcagccagccgtgcaa
caggctgccaccgaagtacgtaacgcctggctggcgctggagcgtactcgtattatcagt
ccgatgaccggttatgtctcccgccgcgcggtacagcctggggcgcaaattagcccaacg
acgccgctgatggcggtcgttccagccaccaatatgtgggtggatgccaactttaaagag
acgcagattgccaatatgcgtatcggtcagccggtcactatcaccacggatatttacggc
gatgatgtgaaatacaccggtaaagtggttggtctggatatgggcacaggtagcgcgttc
tcactgcttccagcgcaaaatgcgaccggtaactggatcaaagtcgttcagcgtctgcct
gtgcgtatcgaactggaccagaaacagctggagcaatatccgctgcgtatcggtttgtcc
acgctggtgagcgtcaataccactaaccgtgacggtcaggtactggcaaataaagtacgt
tccactccggtagcggtaagcaccgcgcgtgaaatcagcctggcacctgtcaataaactg
atcgacgatatcgtaaaagctaacgctggctaa

DBGET integrated database retrieval system