KEGG   Escherichia coli K-12 W3110: JW2661
Entry
JW2661            CDS       T00068                                 
Symbol
emrB
Name
(GenBank) multidrug efflux system protein
  KO
K03446  MFS transporter, DHA2 family, multidrug resistance protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2661 (emrB)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    JW2661 (emrB)
SSDB
Motif
Pfam: MFS_1 OATP MFS_2
Other DBs
NCBI-ProteinID: BAA16548
UniProt: P0AEJ0
Position
2811272..2812810
AA seq 512 aa
MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGV
ANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLI
PLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVA
VVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVV
AVVAICFLIVWELTDDNPIVDLSLFKSRNFTIGCLCISLAYMLYFGAIVLLPQLLQEVYG
YTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMD
FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTM
WTNRESMHHAQLTESVNPFNPNAQAMYSQLEGLGMTQQQASGWIAQQITNQGLIISANEI
FWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgcaacagcaaaaaccgctggaaggcgcgcaactggtcattatgacgattgcgctgtca
ctggcgacattcatgcaggtgctggactccaccattgctaacgtggcgatccccactatc
gccgggaatctgggctcatcgctcagccagggaacgtgggtaatcacttctttcggggtg
gcgaatgccatctcgatcccgcttaccggctggctggcaaagcgcgtcggggaagtgaaa
ctgttcctttggtccaccatcgcctttgctattgcgtcgtgggcgtgtggtgtctccagc
agcctgaatatgctgatcttcttccgcgtgattcaggggattgtcgccgggccgttgatc
ccgctttcgcaaagtctattgctgaataactacccgccagccaaacgctcgatcgcgctg
gcgttgtggtcgatgacggtgattgtcgcgccaatttgcggcccgatcctcggcggttat
atcagcgataattaccactggggctggatattcttcatcaacgtgccgattggcgtggcg
gtggtgttgatgacactgcaaactctgcgcggacgtgaaacccgcaccgaacggcggcgg
attgatgccgtggggctggcactgctggttattggtatcggcagcctgcagattatgctc
gaccgcggtaaagagctggactggttttcatcacaggaaattatcatccttaccgtggtg
gcggtggtggctatctgcttcctgattgtctgggagctgaccgacgataacccgatagtc
gatctgtcgttgtttaagtcgcgcaacttcaccatcggctgcttgtgtatcagcctcgcg
tatatgctctacttcggcgctattgttctgctgccgcagttgttgcaggaggtctacggt
tacacggcgacctgggcaggtttggcctctgcgccggtagggattattccggtgatcctg
tcgccgattatcggccgcttcgcgcataaactggatatgcggcggctggtaaccttcagc
tttattatgtatgccgtctgcttctactggcgtgcctatacctttgaaccaggtatggat
tttggcgcgtcggcctggccgcagtttatccaggggtttgcggtggcctgcttctttatg
ccgctgaccaccattacgctgtctggtttgccaccggaacgactggcggcggcatcgagc
ctctctaactttacgcgaacgctggcggggtctatcggcacgtcgataaccacgaccatg
tggaccaaccgcgagtcgatgcaccatgcgcagttgactgagtcggtaaacccgttcaac
ccgaatgcccaggcgatgtacagtcaactggaagggcttgggatgacgcaacagcaggca
tcaggctggattgcccagcagatcaccaatcaggggctgattatttccgccaatgagatc
ttctggatgtcagccgggatattcctcgtcctgctggggctggtgtggtttgctaaaccg
ccatttggcgcaggtggcggcggaggcggtgcgcactaa

DBGET integrated database retrieval system