KEGG   Escherichia coli K-12 W3110: JW2663
Entry
JW2663            CDS       T00068                                 

Symbol
gshA
Name
(GenBank) gamma-glutamate-cysteine ligase
  KO
K01919  glutamate--cysteine ligase [EC:6.3.2.2]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00270  Cysteine and methionine metabolism
ecj00480  Glutathione metabolism
ecj01100  Metabolic pathways
ecj01240  Biosynthesis of cofactors
Module
ecj_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    JW2663 (gshA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    JW2663 (gshA)
Enzymes [BR:ecj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     JW2663 (gshA)
SSDB
Motif
Pfam: Glu_cys_ligase
Other DBs
NCBI-ProteinID: BAA16555
UniProt: P0A6W9
Structure
Position
complement(2813539..2815095)
AA seq 518 aa
MIPDVSQALAWLEKHPQALKGIQRGLERETLRVNADGTLATTGHPEALGSALTHKWITTD
FAEALLEFITPVDGDIEHMLTFMRDLHRYTARNMGDERMWPLSMPCYIAEGQDIELAQYG
TSNTGRFKTLYREGLKNRYGALMQTISGVHYNFSLPMAFWQAKCGDISGADAKEKISAGY
FRVIRNYYRFGWVIPYLFGASPAICSSFLQGKPTSLPFEKTECGMYYLPYATSLRLSDLG
YTNKSQSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELY
APIRPKRVTRSGESPSDALLRGGIEYIEVRSLDINPFSPIGVDEQQVRFLDLFMVWCALA
DAPEMSSSELACTRVNWNRVILEGRKPGLTLGIGCETAQFPLPQVGKDLFRDLKRVAQTL
DSINGGEAYQKVCDELVACFDNPDLTFSARILRSMIDTGIGGTGKAFAEAYRNLLREEPL
EILREEDFVAEREASERRQQEMEAADTEPFAVWLEKHA
NT seq 1557 nt   +upstreamnt  +downstreamnt
ttgatcccggacgtatcacaggcgctggcctggctggaaaaacatcctcaggcgttaaag
gggatacagcgtgggctggagcgcgaaactttgcgtgttaatgctgatggcacactggca
acaacaggtcatcctgaagcattaggttccgcactgacgcacaaatggattactaccgat
tttgcggaagcattgctggaattcattacaccagtggatggtgatattgaacatatgctg
acctttatgcgcgatctgcatcgttatacggcgcgcaatatgggcgatgagcggatgtgg
ccgttaagtatgccatgctacatcgcagaaggtcaggacatcgaactggcacagtacggc
acttctaacaccggacgctttaaaacgctgtatcgtgaagggctgaaaaatcgctacggc
gcgctgatgcaaaccatttccggcgtgcactacaatttctctttgccaatggcattctgg
caagcgaagtgcggtgatatctcgggcgctgatgccaaagagaaaatttctgcgggctat
ttccgcgttatccgcaattactatcgtttcggttgggtcattccttatctgtttggtgca
tctccggcgatttgttcttctttcctgcaaggaaaaccaacgtcgctgccgtttgagaaa
accgagtgcggtatgtattacctgccgtatgcgacctctcttcgtttgagcgatctcggc
tataccaataaatcgcaaagcaatcttggtattaccttcaacgatctttacgagtacgta
gcgggccttaaacaggcaatcaaaacgccatcggaagagtacgcgaagattggtattgag
aaagacggtaagaggctgcaaatcaacagcaacgtgttgcagattgaaaacgaactgtac
gcgccgattcgtccaaaacgcgttacccgcagcggcgagtcgccttctgatgcgctgtta
cgtggcggcattgaatatattgaagtgcgttcgctggacatcaacccgttctcgccgatt
ggtgtagatgaacagcaggtgcgattcctcgacctgtttatggtctggtgtgcgctggct
gatgcaccggaaatgagcagtagcgaacttgcctgtacacgcgttaactggaaccgggtg
atcctcgaaggtcgcaaaccgggtctgacgctgggtatcggctgcgaaaccgcacagttc
ccgttaccgcaggtgggtaaagatctgttccgcgatctgaaacgcgtcgcgcaaacgctg
gatagtattaacggcggcgaagcgtatcagaaagtgtgtgatgaactggttgcctgcttc
gataatcccgatctgactttctctgcccgtatcttaaggtctatgattgatactggtatt
ggcggaacaggcaaagcatttgcagaagcctaccgtaatctgctgcgtgaagagccgctg
gaaattctgcgcgaagaggattttgtagccgagcgcgaggcgtctgaacgccgtcagcag
gaaatggaagccgctgataccgaaccgtttgcggtgtggctggaaaaacacgcctga

DBGET integrated database retrieval system