KEGG   Escherichia coli K-12 W3110: JW2669Help
Entry
JW2669            CDS       T00068                                 

Gene name
recA
Definition
(GenBank) DNA strand exchange and recombination protein with protease and nuclease activity
  KO
K03553  recombination protein RecA
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    JW2669 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW2669 (recA)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     JW2669 (recA)
    RecFOR pathway proteins
     JW2669 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    JW2669 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase AAA_24 ATPase_2 AAA_16 AAA_25 CbiA AAA_35 PAXNEB MobB AAA_22 AAA Ribosomal_S24e CobU AAA_14 TK DnaB_C ScsC_N
Motif
Other DBs
NCBI-ProteinID: BAA16561
UniProt: P0A7G6
Structure
PDB: 

Position
complement(2821364..2822425)
Genome map
AA seq 353 aa AA seqDB search
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP
DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVG
SETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIG
QGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGVAETNEDF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgacgaaaacaaacagaaagcgttggcggcagcactgggccagattgagaaa
caatttggtaaaggctccatcatgcgcctgggtgaagaccgttccatggatgtggaaacc
atctctaccggttcgctttcactggatatcgcgcttggggcaggtggtctgccgatgggc
cgtatcgtcgaaatctacggaccggaatcttccggtaaaaccacgctgacgctgcaggtg
atcgccgcagcgcagcgtgaaggtaaaacctgtgcgtttatcgatgctgaacacgcgctg
gacccaatctacgcacgtaaactgggcgtcgatatcgacaacctgctgtgctcccagccg
gacaccggcgagcaggcactggaaatctgtgacgccctggcgcgttctggcgcagtagac
gttatcgtcgttgactccgtggcggcactgacgccgaaagcggaaatcgaaggcgaaatc
ggcgactctcacatgggccttgcggcacgtatgatgagccaggcgatgcgtaagctggcg
ggtaacctgaagcagtccaacacgctgctgatcttcatcaaccagatccgtatgaaaatt
ggtgtgatgttcggtaacccggaaaccactaccggtggtaacgcgctgaaattctacgcc
tctgttcgtctcgacatccgtcgtatcggcgcggtgaaagagggcgaaaacgtggtgggt
agcgaaacccgcgtgaaagtggtgaagaacaaaatcgctgcgccgtttaaacaggctgaa
ttccagatcctctacggcgaaggtatcaacttctacggcgaactggttgacctgggcgta
aaagagaagctgatcgagaaagcaggcgcgtggtacagctacaaaggtgagaagatcggt
cagggtaaagcgaatgcgactgcctggctgaaagataacccggaaaccgcgaaagagatc
gagaagaaagtacgtgagttgctgctgagcaacccgaactcaacgccggatttctctgta
gatgatagcgaaggcgtagcagaaactaacgaagatttttaa

DBGET integrated database retrieval system