KEGG   Escherichia coli K-12 W3110: JW2712
Entry
JW2712            CDS       T00068                                 

Symbol
nlpD
Name
(GenBank) predicted outer membrane lipoprotein
  KO
K06194  lipoprotein NlpD
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    JW2712 (nlpD)
SSDB
Motif
Pfam: Peptidase_M23 LysM Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: BAE76819
UniProt: P0ADA3
Position
complement(2866270..2867409)
AA seq 379 aa
MSAGSPKFTVRRIAALSLVSLWLAGCSDTSNPPAPVSSVNGNAPANTNSGMLITPPPKMG
TTSTAQQPQIQPVQQPQIQATQQPQIQPVQPVAQQPVQMENGRIVYNRQYGNIPKGSYSG
STYTVKKGDTLFYIAWITGNDFRDLAQRNNIQAPYALNVGQTLQVGNASGTPITGGNAIT
QADAAEQGVVIKPAQNSTVAVASQPTITYSESSGEQSANKMLPNNKPTATTVTAPVTVPT
ASTTEPTVSSTSTSTPISTWRWPTEGKVIETFGASEGGNKGIDIAGSKGQAIIATADGRV
VYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSTRLH
FEIRYKGKSVNPLRYLPQR
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgagcgcgggaagcccaaaattcaccgttcgccgcattgcggctttgtcactggtttcg
ctatggctggcaggctgttctgacacttcaaatccaccggcaccggtcagctccgttaat
ggcaatgcgcctgcaaatactaattctggtatgttgattacgccgccgccgaaaatgggg
acgacgtctacagcgcagcaaccgcaaattcagccggtgcagcagccacaaattcaggct
actcaacaaccgcaaatccagccagtgcagccagtagctcagcagccggtacagatggaa
aacggacgcatcgtctataaccgtcagtatgggaacattccgaaaggcagttatagcggc
agtacctataccgtgaaaaaaggcgacacacttttctatatcgcctggattactggcaac
gatttccgtgaccttgctcagcgcaacaatattcaggcaccatacgcgctgaacgttggt
cagaccttgcaggtgggtaatgcttccggtacgccaatcactggcggaaatgccattacc
caggccgacgcagcagagcaaggagttgtgatcaagcctgcacaaaattccaccgttgct
gttgcgtcgcaaccgacaattacgtattctgagtcttcgggtgaacagagtgctaacaaa
atgttgccgaacaacaagccaactgcgaccacggtcacagcgcctgtaacggtaccaaca
gcaagcacaaccgagccgactgtcagcagtacatcaaccagtacgcctatctccacctgg
cgctggccgactgagggcaaagtgatcgaaacctttggcgcttctgaggggggcaacaag
gggattgatatcgcaggcagcaaaggacaggcaattatcgcgaccgcagatggccgcgtt
gtttatgctggtaacgcgctgcgcggctacggtaatctgattatcatcaaacataatgat
gattacctgagtgcctacgcccataacgacacaatgctggtccgggaacaacaagaagtt
aaggcggggcaaaaaatagcgaccatgggtagcaccggaaccagttcaacacgcttgcat
tttgaaattcgttacaaggggaaatccgtaaacccgctgcgttatttgccgcagcgataa

DBGET integrated database retrieval system