KEGG   Escherichia coli K-12 W3110: JW2714Help
Entry
JW2714            CDS       T00068                                 

Gene name
surE
Definition
(GenBank) broad specificity 5'(3')-nucleotidase and polyphosphatase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00230  Purine metabolism
ecj00240  Pyrimidine metabolism
ecj00760  Nicotinate and nicotinamide metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JW2714 (surE)
   00240 Pyrimidine metabolism
    JW2714 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    JW2714 (surE)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     JW2714 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: BAE76821
UniProt: P0A840
Position
complement(2868169..2868930)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRH
PADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVV
SDWLNSVGVGTQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatattgctgagtaatgatgacggggtacatgcacccggtatacaaacgctggcg
aaagccttgcgtgagtttgctgacgttcaggtggtcgcccccgatcgtaaccgcagcggc
gcttcaaattctctgacactggaatcctccctgcgcacgtttacctttgaaaatggtgat
attgctgtgcaaatgggaaccccgaccgattgcgtctatcttggcgtgaatgctctgatg
cgtccgcgcccggacattgttgtgtccggaattaacgccgggccgaatctgggggatgat
gttatttattccggtacggtagccgccgcgatggaaggccgtcatttaggttttccggcg
cttgccgtctcgcttgacgggcataaacattacgacactgccgcggcggtaacctgttca
attttgcgcgcactgtgtaaagagccgctgcgcaccgggcgtattcttaatattaacgtt
ccggatttacccttggatcaaatcaaaggtattcgcgtgacgcgctgcggtacacgacat
ccggcagatcaggtgatcccgcagcaagatccgcgcggcaatacgctgtactggattggc
ccgccgggcggtaaatgtgatgctggtccggggaccgattttgctgcggtagatgagggc
tatgtctccatcacgccgctgcatgtggatttaactgcgcatagcgcgcaagatgtggtt
tcagactggttaaacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system