KEGG   Escherichia coli K-12 W3110: JW2772Help
Entry
JW2772            CDS       T00068                                 

Gene name
fucP
Definition
(GenBank) L-fucose transporter
  KO
K02429  MFS transporter, FHS family, L-fucose permease
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW2772 (fucP)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    JW2772 (fucP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr OATP MRAP
Motif
Other DBs
NCBI-ProteinID: BAE76873
UniProt: P11551
Structure
PDB: 

Position
2932891..2934207
Genome map
AA seq 438 aa AA seqDB search
MGNTSIQTQSYRAVDKDAGQSRSYIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTN
FQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYALGAALFWPAAEIMNYTLF
LVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSLILSN
VPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLVALLIMLTKFPALQSDNHS
DAKQGSFSASLSRLARIRHWRWAVLAQFCYVGAQTACWSYLIRYAVEEIPGMTAGFAANY
LTGTMVCFFIGRFTGTWLISRFAPHKVLAAYALIAMALCLISAFAGGHVGLIALTLCSAF
MSIQYPTIFSLGIKNLGQDTKYGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPAL
CFAVIFIFARFRSQTATN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacatcaatacaaacgcagagttaccgtgcggtagataaagatgcagggcaa
agcagaagttacattattccattcgcgctgctgtgctcactgttttttctttgggcggta
gccaataaccttaacgacattttattacctcaattccagcaggcttttacgctgacaaat
ttccaggctggcctgatccaatcggccttttactttggttatttcattatcccaatccct
gctgggatattgatgaaaaaactcagttataaagcagggattattaccgggttattttta
tatgccttgggtgctgcattattctggcccgccgcagaaataatgaactacaccttgttt
ttagttggcctatttattattgcagccggattaggttgtctggaaactgccgcaaaccct
tttgttacggtattagggccggaaagtagtggtcacttccgcttaaatcttgcgcaaaca
tttaactcgtttggcgcaattatcgcggttgtctttgggcaaagtcttattttgtctaac
gtgccacatcaatcgcaagacgttctcgataaaatgtctccagagcaattgagtgcgtat
aaacacagcctggtattatcggtacagacaccttatatgatcatcgtggctatcgtgtta
ctggtcgccctgctgatcatgctgacgaaattcccggcattgcagagtgataatcacagt
gacgccaaacaaggatcgttctccgcatcgctttctcgcctggcgcgtattcgccactgg
cgctgggcggtattagcgcaattctgctatgtcggcgcacaaacggcctgctggagctat
ttgattcgctacgctgtagaagaaattccaggtatgactgcaggctttgccgctaactat
ttaaccggaaccatggtgtgcttctttattggtcgtttcaccggtacctggctcatcagt
cgcttcgcaccacacaaagtcctggccgcctacgcattaatcgctatggcactgtgcctg
atctcagccttcgctggcggtcatgtgggcttaatagccctgactttatgcagcgccttt
atgtcgattcagtacccaacaatcttctcgctgggcattaagaatctcggccaggacacc
aaatatggttcgtccttcatcgttatgaccattattggcggcggtattgtcactccggtc
atgggttttgtcagtgacgcggcgggcaacatccccactgctgaactgatccccgcactc
tgcttcgcggtcatctttatctttgcccgtttccgttctcaaacggcaactaactga

DBGET integrated database retrieval system