KEGG   Escherichia coli K-12 W3110: JW2786
Entry
JW2786            CDS       T00068                                 

Gene name
argA
Definition
(GenBank) fused acetylglutamate kinase homolog (inactive) and amino acid N-acetyltransferase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00220  Arginine biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01210  2-Oxocarboxylic acid metabolism
ecj01230  Biosynthesis of amino acids
Module
ecj_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    JW2786 (argA)
Enzymes [BR:ecj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     JW2786 (argA)
SSDB
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9
Other DBs
NCBI-ProteinID: BAE76887
UniProt: P0A6C5
Position
2947898..2949229
AA seq 443 aa
MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLV
VVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTP
LQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSV
TGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEK
GDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKI
GEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDL
LPESKKQLYNYQRKSKVLMADLG
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtggtaaaggaacgtaaaaccgagttggtcgagggattccgccattcggttccctatatc
aatacccaccggggaaaaacgtttgtcatcatgctcggcggtgaagccattgagcatgag
aatttctccagtatcgttaatgatatcgggttgttgcacagcctcggcatccgtctggtg
gtggtctatggcgcacgtccgcagatcgacgcaaatctggctgcgcatcaccacgaaccg
ctgtatcacaagaatatacgtgtgaccgacgccaaaacactggaactggtgaagcaggct
gcgggaacattgcaactggatattactgctcgcctgtcgatgagtctcaataacacgccg
ctgcagggcgcgcatatcaacgtcgtcagtggcaattttattattgcccagccgctgggc
gtcgatgacggcgtggattactgccatagcgggcgtatccggcggattgatgaagacgcg
atccatcgtcaactggacagcggtgcaatagtgctaatggggccggtcgctgtttcagtc
actggcgagagctttaacctgacctcggaagagattgccactcaactggccatcaaactg
aaagctgaaaagatgattggtttttgctcttcccagggcgtcactaatgacgacggtgat
attgtctccgaacttttccctaacgaagcgcaagcgcgggtagaagcccaggaagagaaa
ggcgattacaactccggtacggtgcgctttttgcgtggcgcagtgaaagcctgccgcagc
ggcgtgcgtcgctgtcatttaatcagttatcaggaagatggcgcgctgttgcaagagttg
ttctcacgcgacggtatcggtacgcagattgtgatggaaagcgccgagcagattcgtcgc
gcaacaatcaacgatattggcggtattctggagttgattcgcccactggagcagcaaggt
attctggtacgccgttctcgcgagcagctggagatggaaatcgacaaattcaccattatt
cagcgcgataacacgactattgcctgcgccgcgctctatccgttcccggaagagaagatt
ggggaaatggcctgtgtggcagttcacccggattaccgcagttcatcaaggggtgaagtt
ctgctggaacgcattgccgctcaggcgaagcagagcggcttaagcaaattgtttgtgctg
accacgcgcagtattcactggttccaggaacgtggatttaccccagtggatattgattta
ctgcccgagagcaaaaagcagttgtacaactaccagcgtaaatccaaagtgttgatggcg
gatttagggtaa

DBGET integrated database retrieval system